ID A3KPP3; PN Ran guanine nucleotide release factor; GN rangrf; OS 7955; SL Nucleus Position: SL-0198; SL Comments: Nucleus {ECO:0000250|UniProtKB:Q9HD47}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q9HD47}. Cytoplasm {ECO:0000250|UniProtKB:Q9HD47}. Cell membrane {ECO:0000250|UniProtKB:Q9HD47}; Peripheral membrane protein {ECO:0000250|UniProtKB:Q9HD47}; Cytoplasmic side {ECO:0000250|UniProtKB:Q9HD47}. Note=May shuttle between the nucleus and cytoplasm. {ECO:0000250|UniProtKB:Q9HD47}. DR UNIPROT: A3KPP3; DR UNIPROT: A7E2J7; DR Pfam: PF04603; DE Function: May regulate the intracellular trafficking of RAN. Promotes guanine nucleotide release from RAN and inhibits binding of new GTP. Plays a role in the regulation of the levels of GTP-bound RAN in the nucleus (By similarity). Required for normal expression of the ion channel hcn4 and for normal expression of the cardiac transcription factors nkx2.5, gata4 and hand2 during embryonic development. Required for normal embryonic heart development and normal heart rate (PubMed:26903377). {ECO:0000250|UniProtKB:Q9HD47, ECO:0000269|PubMed:26903377}. DE Reference Proteome: Yes; GO GO:0005634; GO GO:0048471; GO GO:0005886; GO GO:0005085; GO GO:0031267; GO GO:0017080; GO GO:0044325; GO GO:0060047; GO GO:0001947; GO GO:0006606; GO GO:0003254; GO GO:0042391; GO GO:2000649; TP Membrane Topology: Peripheral; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:Q9HD47}; SQ MSRPLFGGALSAVFPSSVMDISELRQIPDNQEVFAHSQTDQSIIIELLEYQSQVQDADAARYHFEDVAGSNKAIENGTWE SQ VRVVEQVPQSEISMQECSSAWLLSGAQLVSKFNEEAKNTVNVHQCLFRLPQFTTDILMTFNDPVFINPLSSSAAGNMEAI SQ PWTLQDFQGVLQSLRLLDSGVFG //