ID A5A6S6; PN Trimeric intracellular cation channel type A; GN TMEM38A; OS 9986; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Sarcoplasmic reticulum membrane {ECO:0000269|PubMed:17611541}; Multi-pass membrane protein {ECO:0000269|PubMed:17611541}. Nucleus membrane {ECO:0000269|PubMed:17611541}. DR UNIPROT: A5A6S6; DR Pfam: PF05197; DE Function: Monovalent cation channel required for maintenance of rapid intracellular calcium release. May act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores. {ECO:0000250|UniProtKB:Q3TMP8, ECO:0000269|PubMed:17611541}. DE Reference Proteome: Yes; DE Interaction: A5A6S6; IntAct: EBI-15646438; Score: 0.52 GO GO:0016021; GO GO:0031965; GO GO:0033017; GO GO:0042802; GO GO:0005267; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MELLSALSLGELALSFSRVPLFPVFDLSYFIVSILYLKYEPGAVELSRRHPVASWLCAMLHCFGSYILADLLLGEPLIDY SQ FSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKEVVRVRKIAVGIHHAHHHYHHGWFIMIATGWVKGSGVA SQ LLSNVEQLLRGVWKPETNEILHMSFPTKASLYGAILFTLQQTRWLPVSKASLIFIFTMFMVSCKVFLTATHSHSSPFDVL SQ EAYVCPVLFGTGSGGDHPQDNHGAWPGGPPSGALATKSKEELSEGSRKKKTKKAD //