ID B9X187; PN Nuclear envelope integral membrane protein 1a; GN nemp1a; OS 8355; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0179; SL Nucleus Position: SL-0182; SL Comments: Nucleus inner membrane {ECO:0000269|PubMed:19167377, ECO:0000269|PubMed:25946333}; Multi-pass membrane protein; Nucleoplasmic side {ECO:0000269|PubMed:19167377}. Nucleus envelope {ECO:0000269|PubMed:19167377}. Note=Localization in the nuclear membrane is essential for its function. Colocalizes with lamins and banf1-a/b at the nuclear envelope. {ECO:0000269|PubMed:19167377, ECO:0000269|PubMed:25946333}. DR UNIPROT: B9X187; DR UNIPROT: Q0IH41; DR Pfam: PF10225; DE Function: In concert with ran, required for proper eye development (PubMed:25946333). May be involved in the expression of early eye marker genes (PubMed:19167377). Contributes to nuclear envelope stiffness in germ cells (By similarity). Required for fertility (By similarity). {ECO:0000250|UniProtKB:O14524, ECO:0000269|PubMed:19167377, ECO:0000269|PubMed:25946333}. DE Reference Proteome: Yes; DE Interaction: A1L3G9; IntAct: EBI-12597651; Score: 0.40 DE Interaction: P52301; IntAct: EBI-12596100; Score: 0.40 DE Interaction: Q66KV4; IntAct: EBI-12596342; Score: 0.46 GO GO:0016021; GO GO:0005635; GO GO:0005637; GO GO:0043621; GO GO:0001654; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MAGDVEGGGCRVSWGALLTLLLLPLPSLCTLASGKEPHVIKLYEGKVVRYNESKNFCYQRTYEPKWSDVWTKIQIRVNST SQ KMIRVTQVENEEKLKEMETFNMFDLFSSFLKEKLNDTFIYVDLYSNKTCIKVHVIDTDTYYSVALSRGFDPRLCFLFLCG SQ LLLFFYGDALSRSQLFFYSTGITIGMLASMLILVFMLSKLMPKKSPFVALLLGGWSVSIYIIQLVFKNLQAICSEYWQYL SQ LGYLGIVGFVSFAFCYKYGPLENDRSINILTWTLQLIGLLLMYISVQIQHIAVTMVVIAFCTKQIEYPVQWIYILYRKIK SQ RKRAKPSPPRLLTEEEYRKQGEIETRKALEELRGYCSSPDFATWKMISRIQSPKRFADFVEGSSHLTPNEVSVHEHEYGL SQ GGSFLEDELFGEDSDIEVEMDIEQPLYLVPRSCF //