ID D3Z5T1; PN Coiled-coil domain-containing protein 78; GN Ccdc78; OS 10090; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole {ECO:0000250}. Cytoplasm, perinuclear region {ECO:0000250}. Cell membrane, sarcolemma {ECO:0000250}. Sarcoplasmic reticulum {ECO:0000250}. Note=Localizes to centrioles and deuterosome. Found primarily in the perinuclear region as well as along the sarcolemmal membrane and in reticular pattern within the sarcoplasm (By similarity). {ECO:0000250}. DR UNIPROT: D3Z5T1; DR Pfam: PF14739; DE Function: Component of the deuterosome, a structure that promotes de novo centriole amplification in multiciliated cells that can generate more than 100 centrioles. Deuterosome-mediated centriole amplification occurs in terminally differentiated multiciliated cells (G1/0) and not in S phase. Essential for centriole amplification and is required for CEP152 localization to the deuterosome (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0005814; GO GO:0005737; GO GO:0098536; GO GO:0048471; GO GO:0042383; GO GO:0016529; GO GO:0030030; GO GO:0098535; GO GO:0003009; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MDQRPELLSSMEYVASPDPKPGVPLRVAENVAPGAEDWLPSASGHLAWATSLETEHQTHLELSEEQRLQISKELVDLQIA SQ THHLREQHEAEVFELRREILRLESRVLELELHGNGACQGHKVQPMANLGQHQVPPLEPPGGQQKLQEELKWLLEHHRARQ SQ QALETQVGVLSQQLQGAREEARTTGQQLASQAMVLASCKGQLRQAEAENTQLQLQLKKMNEEYAVRLQHYARETVENASS SQ TNQAALQAFLESTLQDIRAAHRTREQQLAQAARTYRKRLADLNQRQELLLTTCRATFATAINLEPLPMHWATELSHPREN SQ EYGRHRTLLLYPEKGSGETSKENKSQPLALDTASWAQIQQRLQDFSQDTQAELERERAQLMVRATMAEQQLSELQEYVDQ SQ HLGRYKQEILKLRKLVNIGDPQGVEAVSSPGSGGARL //