ID  O01971;
PN  Emerin homolog 1;
GN  emr;
OS  6239;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0179;
SL  Nucleus Position: SL-0182;
SL  Comments: Nucleus inner membrane {ECO:0000269|PubMed:10982402, ECO:0000269|PubMed:11870211, ECO:0000269|PubMed:12490171}; Single-pass membrane protein {ECO:0000269|PubMed:10982402, ECO:0000269|PubMed:11870211, ECO:0000269|PubMed:12490171}; Nucleoplasmic side {ECO:0000269|PubMed:10982402, ECO:0000269|PubMed:11870211, ECO:0000269|PubMed:12490171}. Nucleus envelope {ECO:0000269|PubMed:16950114, ECO:0000269|PubMed:25653391}. Note=Lmn-1 and mel-28 are required for its localization to the nuclear envelope (PubMed:11870211, PubMed:16950114). Remains in the nuclear envelope until mid-late anaphase (PubMed:10982402). Recruited to the reforming nuclear envelope from telophase and throughout interphase (PubMed:25653391). {ECO:0000269|PubMed:10982402, ECO:0000269|PubMed:11870211, ECO:0000269|PubMed:16950114, ECO:0000269|PubMed:25653391}.
DR  UNIPROT: O01971;
DR  Pfam: PF03020;
DR  PROSITE: PS50954;
DE  Function: Nuclear lamina-associated inner nuclear membrane protein that is involved in cell division, nuclear structure organization, maintenance of nuclear envelope integrity and nuclear envelope reformation after mitosis (PubMed:11870211, PubMed:12684533, PubMed:22171324). Involved in chromosome segregation and cell division, probably via its interaction with the nuclear intermediate filament protein lmn-1, the main component of nuclear lamina (PubMed:11870211, PubMed:12684533). Required to organize the distribution of lmn-1, nuclear pore complexes (NPCs) and chromatin in mitotically active cells (PubMed:22171324). Together with lem-2, plays a role in baf-1 enrichment at the nuclear envelope in anaphase (PubMed:12684533). Together with lem-2, involved in muscle cell attachment to hypodermal cells, as well as muscle cell location and sarcomere organization (PubMed:22171324). May play a role in radiation-induced DNA damage repair response (PubMed:22383942). May repress binding of transcription factor pha-4 with target sequences in pharyngeal cells. {ECO:0000269|PubMed:11870211, ECO:0000269|PubMed:12684533, ECO:0000269|PubMed:20714352, ECO:0000269|PubMed:22171324, ECO:0000269|PubMed:22383942}.
DE  Reference Proteome: Yes;
DE  Interaction: Q9XTB5; IntAct: EBI-6260324; Score: 0.27
GO  GO:0005639;
GO  GO:0005635;
GO  GO:0005521;
GO  GO:0007059;
GO  GO:0000281;
GO  GO:0006998;
GO  GO:0010165;
TP  Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255};
SQ  MDVSQLTDAELRDSLKSHGVSVGPIVATTRKLYEKKLIKLSDGSINNQSNLNDSQFNEDSLIISSSPKKSPPQRVFQNVS
SQ  AATAAATTSPESDSDDCEESMRYLTEEEMAADRASARQAQSNKGGFLGSTITFTILFVFIAVFAYFLIENAEQLKLVAET
SQ  NPEDTI
//