ID O14770; PN Homeobox protein Meis2; GN MEIS2; OS 9606; SL Nucleus Position: SL-0198; SL Comments: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00108}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:P97367}. DR UNIPROT: O14770; DR UNIPROT: A6NJI5; DR UNIPROT: A8MWD5; DR UNIPROT: B3KP98; DR UNIPROT: B3KPQ6; DR UNIPROT: Q96DI2; DR UNIPROT: Q96KI4; DR UNIPROT: Q96KI5; DR UNIPROT: Q9NRS1; DR UNIPROT: Q9NRS2; DR UNIPROT: Q9NRS3; DR PDB: 3K2A; DR PDB: 4XRM; DR PDB: 5BNG; DR PDB: 5EG0; DR Pfam: PF05920; DR Pfam: PF16493; DR PROSITE: PS50071; DR OMIM: 600987; DR OMIM: 601740; DR DisGeNET: 4212; DE Function: Involved in transcriptional regulation. Binds to HOX or PBX proteins to form dimers, or to a DNA-bound dimer of PBX and HOX proteins and thought to have a role in stabilization of the homeoprotein-DNA complex. Isoform 3 is required for the activity of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element; MEIS2 is not involved in complex DNA-binding. Probably in complex with PBX1, is involved in transcriptional regulation by KLF4. Isoform 3 and isoform 4 can bind to a EPHA8 promoter sequence containing the DNA motif 5'-CGGTCA-3'; in cooperation with a PBX protein (such as PBX2) is proposed to be involved in the transcriptional activation of EPHA8 in the developing midbrain. May be involved in regulation of myeloid differentiation. Can bind to the DNA sequence 5'-TGACAG-3'in the activator ACT sequence of the D(1A) dopamine receptor (DRD1) promoter and activate DRD1 transcription; isoform 5 cannot activate DRD1 transcription. {ECO:0000269|PubMed:10764806, ECO:0000269|PubMed:11279116, ECO:0000269|PubMed:21746878}. DE Disease: Cleft palate, cardiac defects, and intellectual disability (CPCMR) [MIM:600987]: An autosomal dominant disease characterized by multiple congenital malformations, mild-to-severe intellectual disability with poor speech, and delayed psychomotor development. Congenital malformations include heart defects, cleft lip/palate, distally-placed thumbs and toes, and cutaneous syndactyly between the second and third toes. {ECO:0000269|PubMed:24678003, ECO:0000269|PubMed:25712757, ECO:0000269|PubMed:27225850}. Note=The disease is caused by variants affecting the gene represented in this entry. DE Reference Proteome: Yes; DE Interaction: P40424; IntAct: EBI-8025844; Score: 0.68 DE Interaction: Q5NG24; IntAct: EBI-2804943; Score: 0.00 DE Interaction: P55347; IntAct: EBI-6390229; Score: 0.37 DE Interaction: P31314; IntAct: EBI-6390224; Score: 0.51 DE Interaction: P03363; IntAct: EBI-9676160; Score: 0.56 DE Interaction: A0A1B0GWI1; IntAct: EBI-10181425; Score: 0.56 DE Interaction: Q5TZZ9; IntAct: EBI-10181439; Score: 0.56 DE Interaction: Q6P1W5; IntAct: EBI-10181449; Score: 0.56 DE Interaction: Q9UJX0; IntAct: EBI-10322586; Score: 0.67 DE Interaction: O14770; IntAct: EBI-10483276; Score: 0.37 DE Interaction: Q9HBZ2; IntAct: EBI-21247219; Score: 0.37 DE Interaction: X5DP20; IntAct: EBI-21248814; Score: 0.37 DE Interaction: P08563; IntAct: EBI-11477846; Score: 0.40 DE Interaction: Q93062; IntAct: EBI-11770334; Score: 0.49 DE Interaction: Q9BYU1; IntAct: EBI-24325661; Score: 0.56 DE Interaction: A8MTQ0; IntAct: EBI-25245194; Score: 0.56 DE Interaction: P78424; IntAct: EBI-25257117; Score: 0.56 DE Interaction: Q3LHN2; IntAct: EBI-24519607; Score: 0.56 DE Interaction: Q8NCR6; IntAct: EBI-24521509; Score: 0.56 DE Interaction: P60410; IntAct: EBI-25265493; Score: 0.56 DE Interaction: Q9NP55; IntAct: EBI-24617898; Score: 0.56 DE Interaction: Q3LI66; IntAct: EBI-24620047; Score: 0.56 DE Interaction: Q9BVN2; IntAct: EBI-24627135; Score: 0.56 DE Interaction: O43482; IntAct: EBI-24629906; Score: 0.56 DE Interaction: Q16568; IntAct: EBI-24671746; Score: 0.56 DE Interaction: P17568; IntAct: EBI-24678228; Score: 0.56 DE Interaction: Q99990; IntAct: EBI-24686169; Score: 0.56 DE Interaction: Q96C01; IntAct: EBI-24689631; Score: 0.56 DE Interaction: Q13207; IntAct: EBI-24726892; Score: 0.56 DE Interaction: Q9BQD7; IntAct: EBI-24753048; Score: 0.56 DE Interaction: P59942; IntAct: EBI-24764157; Score: 0.56 DE Interaction: Q3LI64; IntAct: EBI-24764080; Score: 0.56 DE Interaction: Q8IWZ5; IntAct: EBI-24787203; Score: 0.56 DE Interaction: P78358; IntAct: EBI-24405116; Score: 0.56 DE Interaction: Q9BVL2; IntAct: EBI-24450131; Score: 0.56 DE Interaction: Q16633; IntAct: EBI-24562025; Score: 0.56 DE Interaction: Q3LI70; IntAct: EBI-24577653; Score: 0.56 DE Interaction: P18825; IntAct: EBI-24590919; Score: 0.56 DE Interaction: Q8IUC1; IntAct: EBI-24591528; Score: 0.56 DE Interaction: P09683; IntAct: EBI-24636392; Score: 0.56 DE Interaction: P24592; IntAct: EBI-24646860; Score: 0.56 DE Interaction: Q9Y5J6; IntAct: EBI-24654937; Score: 0.56 DE Interaction: Q13882; IntAct: EBI-24774645; Score: 0.56 DE Interaction: Q92567; IntAct: EBI-24803604; Score: 0.56 DE Interaction: Q13352; IntAct: EBI-24806788; Score: 0.56 DE Interaction: O60663; IntAct: EBI-21538601; Score: 0.35 DE Interaction: Q9Y2B2; IntAct: EBI-21552063; Score: 0.35 DE Interaction: P60709; IntAct: EBI-21552063; Score: 0.35 DE Interaction: P40426; IntAct: EBI-21552063; Score: 0.35 DE Interaction: P40425; IntAct: EBI-21552063; Score: 0.35 DE Interaction: O00470; IntAct: EBI-21552063; Score: 0.35 DE Interaction: A6NDR6; IntAct: EBI-21552063; Score: 0.35 DE Interaction: Q8IYS4; IntAct: EBI-21565697; Score: 0.35 DE Interaction: Q96HB5; IntAct: EBI-21618177; Score: 0.35 DE Interaction: Q9Y586; IntAct: EBI-21671820; Score: 0.35 DE Interaction: Q5U5X8; IntAct: EBI-21671625; Score: 0.35 DE Interaction: Q13394; IntAct: EBI-21671570; Score: 0.35 DE Interaction: Q9NYL9; IntAct: EBI-21701240; Score: 0.35 DE Interaction: D3DTS7; IntAct: EBI-25882772; Score: 0.56 DE Interaction: P48431; IntAct: EBI-26574619; Score: 0.35 DE Interaction: Q14258; IntAct: EBI-26683485; Score: 0.37 DE Interaction: Q15649; IntAct: EBI-26685693; Score: 0.37 DE Interaction: P35226; IntAct: EBI-27109494; Score: 0.35 DE Interaction: P46937; IntAct: EBI-30845845; Score: 0.44 GO GO:0000785; GO GO:0005634; GO GO:0048471; GO GO:0003677; GO GO:0001228; GO GO:0000981; GO GO:0000978; GO GO:0043565; GO GO:1990837; GO GO:0008134; GO GO:0009887; GO GO:0007420; GO GO:0009880; GO GO:0001654; GO GO:0045638; GO GO:0000122; GO GO:0031016; GO GO:0110024; GO GO:0008284; GO GO:0045931; GO GO:0045944; GO GO:0006357; GO GO:0070848; GO GO:0009612; GO GO:0008542; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAI SQ YGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLE SQ LEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGH SQ ASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTI SQ LQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGM SQ SMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ //