ID  O14966;
PN  Ras-related protein Rab-7L1;
GN  RAB29;
OS  9606;
SL  Nucleus Position: SL-0198;
SL  Comments: Cell membrane {ECO:0000305}; Lipid-anchor {ECO:0000305}; Cytoplasmic side {ECO:0000305}. Cytoplasm {ECO:0000269|PubMed:24788816, ECO:0000269|PubMed:29212815}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:24788816}. Golgi apparatus {ECO:0000269|PubMed:22042847}. Golgi apparatus, trans-Golgi network {ECO:0000269|PubMed:24788816, ECO:0000269|PubMed:29212815}. Vacuole {ECO:0000269|PubMed:22042847}. Cytoplasm, cytoskeleton {ECO:0000269|PubMed:22042847}. Note=Colocalizes with LRRK2 along tubular structures emerging from Golgi apparatus (PubMed:29212815). Colocalizes with GM130 at the Golgi apparatus (PubMed:22042847). Colocalizes with dynamic tubules emerging from and retracting to the Golgi apparatus (PubMed:22042847). Colocalizes with TGN46 at the trans- Golgi network (TGN) (PubMed:24788816). In Salmonella enterica serovar Typhi (S.Typhi) infected epithelial cells, is recruited and colocalized with both S.Typhi-containing vacuoles and dynamic tubules as well as those emerging from the vacuole toward the cell periphery (PubMed:22042847). {ECO:0000269|PubMed:22042847, ECO:0000269|PubMed:24788816, ECO:0000269|PubMed:29212815}.
DR  UNIPROT: O14966;
DR  UNIPROT: B4E1K3;
DR  UNIPROT: C9JE77;
DR  PDB: 6HH2;
DR  Pfam: PF00071;
DR  PROSITE: PS51419;
DR  OMIM: 603949;
DR  DisGeNET: 8934;
DE  Function: The small GTPases Rab are key regulators in vesicle trafficking (PubMed:24788816). Essential for maintaining the integrity of the endosome-trans-Golgi network structure (By similarity). Together with LRRK2, plays a role in the retrograde trafficking pathway for recycling proteins, such as mannose 6 phosphate receptor (M6PR), between lysosomes and the Golgi apparatus in a retromer-dependent manner (PubMed:24788816). Recruits LRRK2 to the Golgi complex and stimulates LRRK2 kinase activity (PubMed:29212815). Regulates neuronal process morphology in the intact central nervous system (CNS) (By similarity). May play a role in the formation of typhoid toxin transport intermediates during Salmonella enterica serovar Typhi (S.Typhi) epithelial cell infection (PubMed:22042847). {ECO:0000250|UniProtKB:Q63481, ECO:0000269|PubMed:22042847, ECO:0000269|PubMed:24788816, ECO:0000269|PubMed:29212815}.
DE  Reference Proteome: Yes;
DE  Interaction: Q9UK45; IntAct: EBI-373977; Score: 0.00
DE  Interaction: A0A380PDF6; IntAct: EBI-2856699; Score: 0.00
DE  Interaction: Q5S007; IntAct: EBI-9247238; Score: 0.76
DE  Interaction: P11142; IntAct: EBI-9247728; Score: 0.35
DE  Interaction: O14976; IntAct: EBI-9247728; Score: 0.35
DE  Interaction: P14373; IntAct: EBI-24492416; Score: 0.56
DE  Interaction: Q04864; IntAct: EBI-24371046; Score: 0.56
DE  Interaction: O95751; IntAct: EBI-24414905; Score: 0.67
DE  Interaction: Q13049; IntAct: EBI-24451423; Score: 0.56
DE  Interaction: Q9NVJ2; IntAct: EBI-21858632; Score: 0.35
DE  Interaction: Q96LI5; IntAct: EBI-21858632; Score: 0.35
DE  Interaction: Q92696; IntAct: EBI-21858632; Score: 0.35
DE  Interaction: Q5VSL9; IntAct: EBI-21858632; Score: 0.35
DE  Interaction: Q14643; IntAct: EBI-21858632; Score: 0.35
DE  Interaction: Q14573; IntAct: EBI-21858632; Score: 0.35
DE  Interaction: Q14571; IntAct: EBI-21858632; Score: 0.35
DE  Interaction: Q04656; IntAct: EBI-21858632; Score: 0.35
DE  Interaction: P26374; IntAct: EBI-21858632; Score: 0.35
DE  Interaction: P24386; IntAct: EBI-21858632; Score: 0.35
DE  Interaction: H9L447; IntAct: EBI-15950513; Score: 0.44
DE  Interaction: Q9H6J7; IntAct: EBI-22145198; Score: 0.37
DE  Interaction: Q9ULR3; IntAct: EBI-22223478; Score: 0.35
DE  Interaction: P57729; IntAct: EBI-22225674; Score: 0.40
DE  Interaction: Q8TEV9; IntAct: EBI-26618985; Score: 0.40
GO  GO:0005801;
GO  GO:0005737;
GO  GO:0005856;
GO  GO:0005829;
GO  GO:0005769;
GO  GO:0070062;
GO  GO:0005794;
GO  GO:0043231;
GO  GO:0097708;
GO  GO:0042470;
GO  GO:0005739;
GO  GO:0048471;
GO  GO:0005886;
GO  GO:0055037;
GO  GO:0005802;
GO  GO:0005773;
GO  GO:0070840;
GO  GO:0019003;
GO  GO:0005525;
GO  GO:0003924;
GO  GO:0019894;
GO  GO:0031267;
GO  GO:0030154;
GO  GO:0007030;
GO  GO:0006886;
GO  GO:0032438;
GO  GO:0007005;
GO  GO:0044788;
GO  GO:0010977;
GO  GO:0090316;
GO  GO:0001921;
GO  GO:0050862;
GO  GO:1903441;
GO  GO:0072657;
GO  GO:1901214;
GO  GO:1905279;
GO  GO:0009617;
GO  GO:0042147;
GO  GO:0007416;
GO  GO:0042110;
GO  GO:1901998;
TP  Membrane Topology: Lipid-Anchored; Source: UniProt - By Similarity {ECO:0000250};
SQ  MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRD
SQ  ASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENK
SQ  NINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC
//