ID  O15182;
PN  Centrin-3;
GN  CETN3;
OS  9606;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0185;
SL  Comments: Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000269|PubMed:14654843, ECO:0000269|PubMed:9256449}. Nucleus, nucleolus {ECO:0000303|PubMed:22307388}. Nucleus envelope {ECO:0000269|PubMed:23591820}. Nucleus, nuclear pore complex {ECO:0000269|PubMed:23591820}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole {ECO:0000269|PubMed:23591820, ECO:0000269|PubMed:26337392}. Note=Centrosome of interphase and mitotic cells (PubMed:9256449). Localizes to centriole distal lumen (PubMed:26337392). Localization at the nuclear pore complex requires NUP153 and TPR (PubMed:23591820). {ECO:0000269|PubMed:23591820, ECO:0000269|PubMed:26337392, ECO:0000269|PubMed:9256449}.
DR  UNIPROT: O15182;
DR  UNIPROT: Q53YD2;
DR  UNIPROT: Q9BS23;
DR  Pfam: PF13499;
DR  PROSITE: PS00018;
DR  PROSITE: PS50222;
DR  OMIM: 602907;
DR  DisGeNET: 1070;
DE  Function: Plays a fundamental role in microtubule-organizing center structure and function. As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm through the nuclear pores. {ECO:0000269|PubMed:22307388, ECO:0000305|PubMed:23591820}.
DE  Reference Proteome: Yes;
DE  Interaction: O43924; IntAct: EBI-729774; Score: 0.00
DE  Interaction: Q5UIP0; IntAct: EBI-729777; Score: 0.00
DE  Interaction: Q13432; IntAct: EBI-729780; Score: 0.00
DE  Interaction: O95229; IntAct: EBI-1001131; Score: 0.35
DE  Interaction: Q6UVJ0; IntAct: EBI-1570168; Score: 0.27
DE  Interaction: Q70CQ1; IntAct: EBI-2512828; Score: 0.40
DE  Interaction: Q9R1K9; IntAct: EBI-2561097; Score: 0.40
DE  Interaction: Q9H0K1; IntAct: EBI-2910196; Score: 0.27
DE  Interaction: Q9Y6K9; IntAct: EBI-5772724; Score: 0.00
DE  Interaction: P04792; IntAct: EBI-6872539; Score: 0.37
DE  Interaction: Q2NKQ1; IntAct: EBI-10182468; Score: 0.72
DE  Interaction: Q8NA72; IntAct: EBI-10182480; Score: 0.80
DE  Interaction: Q15293; IntAct: EBI-24265783; Score: 0.56
DE  Interaction: O95994; IntAct: EBI-24269242; Score: 0.56
DE  Interaction: P19237; IntAct: EBI-24271146; Score: 0.56
DE  Interaction: P17540; IntAct: EBI-24678114; Score: 0.56
DE  Interaction: O00141; IntAct: EBI-24728013; Score: 0.56
DE  Interaction: O43679; IntAct: EBI-24793336; Score: 0.56
DE  Interaction: Q12798; IntAct: EBI-21576600; Score: 0.35
DE  Interaction: Q8N490; IntAct: EBI-21596986; Score: 0.35
DE  Interaction: Q96EV8; IntAct: EBI-21651992; Score: 0.35
DE  Interaction: O00212; IntAct: EBI-21717184; Score: 0.35
DE  Interaction: O14874; IntAct: EBI-21725538; Score: 0.53
DE  Interaction: O95976; IntAct: EBI-21725569; Score: 0.35
DE  Interaction: Q01831; IntAct: EBI-21725721; Score: 0.53
DE  Interaction: P18509; IntAct: EBI-21725612; Score: 0.35
DE  Interaction: Q5VW00; IntAct: EBI-21725806; Score: 0.35
DE  Interaction: O15273; IntAct: EBI-21729416; Score: 0.40
DE  Interaction: Q5S007; IntAct: EBI-20587935; Score: 0.44
DE  Interaction: Q9Y4C4; IntAct: EBI-20589725; Score: 0.44
DE  Interaction: Q92844; IntAct: EBI-20737201; Score: 0.35
DE  Interaction: Q9UQ80; IntAct: EBI-20904872; Score: 0.40
DE  Interaction: Q5T7N2; IntAct: EBI-20993270; Score: 0.35
DE  Interaction: P13473; IntAct: EBI-25872710; Score: 0.56
DE  Interaction: Q9Y371; IntAct: EBI-25921828; Score: 0.56
DE  Interaction: P0C6X7; IntAct: EBI-26376977; Score: 0.35
GO  GO:0005814;
GO  GO:0005813;
GO  GO:0036064;
GO  GO:0005737;
GO  GO:0005815;
GO  GO:0044615;
GO  GO:0005730;
GO  GO:0032391;
GO  GO:0070390;
GO  GO:0005509;
GO  GO:0031683;
GO  GO:0008017;
GO  GO:0051301;
GO  GO:0007098;
GO  GO:0051028;
GO  GO:0015031;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGK
SQ  ITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFI
SQ  AIMTGDI
//