ID  O35387;
PN  HCLS1-associated protein X-1;
GN  Hax1;
OS  10090;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0182;
SL  Comments: Mitochondrion {ECO:0000269|PubMed:16814492}. Endoplasmic reticulum {ECO:0000269|PubMed:10760273}. Nucleus membrane {ECO:0000305|PubMed:16814492}. Cytoplasmic vesicle {ECO:0000269|PubMed:10760273, ECO:0000269|PubMed:16814492}. Cytoplasm, cell cortex {ECO:0000250|UniProtKB:O00165}. Cell membrane {ECO:0000250|UniProtKB:O00165}; Peripheral membrane protein {ECO:0000250|UniProtKB:O00165}; Cytoplasmic side {ECO:0000250|UniProtKB:O00165}. Sarcoplasmic reticulum {ECO:0000250|UniProtKB:Q7TSE9}. Cytoplasm, P-body {ECO:0000250|UniProtKB:O00165}. Cytoplasm {ECO:0000250|UniProtKB:O00165}. Nucleus {ECO:0000250|UniProtKB:O00165}. Note=Predominantly cytoplasmic. Also detected in the nucleus when nuclear export is inhibited (in vitro). {ECO:0000250|UniProtKB:O00165}.
DR  UNIPROT: O35387;
DR  UNIPROT: Q542F8;
DE  Function: Recruits the Arp2/3 complex to the cell cortex and regulates reorganization of the cortical actin cytoskeleton via its interaction with KCNC3 and the Arp2/3 complex. Slows down the rate of inactivation of KCNC3 channels. Promotes GNA13-mediated cell migration. Involved in the clathrin-mediated endocytosis pathway. May be involved in internalization of ABC transporters such as ABCB11. May inhibit CASP9 and CASP3. Promotes cell survival. May regulate intracellular calcium pools. {ECO:0000250|UniProtKB:O00165}.
DE  Reference Proteome: Yes;
DE  Interaction: P42227; IntAct: EBI-657283; Score: 0.37
DE  Interaction: Q8BWG8; IntAct: EBI-649719; Score: 0.37
DE  Interaction: Q8CIH5; IntAct: EBI-649769; Score: 0.37
DE  Interaction: Q13563; IntAct: EBI-9635489; Score: 0.51
DE  Interaction: O14925; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: Q9H477; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: H3BS42; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: P56199; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: P10809; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: P37198; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: Q92604; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: P12236; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: Q9H061; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: Q7KZ85; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: O15066; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: Q9H078; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: O75165; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: G3XAN4; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: B4E1G1; IntAct: EBI-11010276; Score: 0.35
DE  Interaction: Q5XJY4; IntAct: EBI-15687233; Score: 0.52
DE  Interaction: Q9JIY5; IntAct: EBI-15687275; Score: 0.52
DE  Interaction: Q9NRI5; IntAct: EBI-26612017; Score: 0.35
GO  GO:0015629;
GO  GO:0016324;
GO  GO:0005938;
GO  GO:0030136;
GO  GO:0005737;
GO  GO:0005783;
GO  GO:0043231;
GO  GO:0030027;
GO  GO:0005758;
GO  GO:0005741;
GO  GO:0005739;
GO  GO:0031965;
GO  GO:0000932;
GO  GO:0016529;
GO  GO:0005667;
GO  GO:0019966;
GO  GO:0019904;
GO  GO:0047485;
GO  GO:0007166;
GO  GO:0071345;
GO  GO:0043066;
GO  GO:2000251;
GO  GO:0030854;
GO  GO:0033138;
GO  GO:0050731;
GO  GO:0014068;
GO  GO:0051897;
GO  GO:0045944;
GO  GO:0030833;
TP  Membrane Topology: Peripheral; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:O00165};
SQ  MSVFDLFRGFFGFPGPRSHRDPFFGGMTRDDDDDDDDDDEAEEDRGAWGRESYAFDGSQPPEEFGFSFSPRGGMRFHGNF
SQ  GFDDLVRDFNSIFSEMGAWTLPSHSPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFEGVLESHAKPESPKPAPD
SQ  WGSQGPFHRLDDTWPVSPHSRAKEDKDLDSQVSQEGLGPLLQPQPKSYFKSISVTKITKPDGTVEERRTVVDSEGRRETT
SQ  VTHQEAHDSSRSDPDSQRSSALDDPFSILDLLLGRWFRSR
//