ID O35648; PN Centrin-3; GN Cetn3; OS 10090; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0185; SL Comments: Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000250|UniProtKB:O15182}. Nucleus, nucleolus {ECO:0000250|UniProtKB:O15182}. Nucleus envelope {ECO:0000250|UniProtKB:O15182}. Nucleus, nuclear pore complex {ECO:0000250|UniProtKB:O15182}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole {ECO:0000250|UniProtKB:O15182}. Note=Centrosome of interphase and mitotic cells. Localizes to centriole distal lumen (By similarity). Localization at the nuclear pore complex requires NUP153 and TPR (By similarity). {ECO:0000250|UniProtKB:O15182}. DR UNIPROT: O35648; DR Pfam: PF13499; DR PROSITE: PS00018; DR PROSITE: PS50222; DE Function: Plays a fundamental role in microtubule-organizing center structure and function. As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm through the nuclear pores. {ECO:0000250|UniProtKB:O15182}. DE Reference Proteome: Yes; GO GO:0005814; GO GO:0005813; GO GO:0036064; GO GO:0035869; GO GO:0005737; GO GO:0005815; GO GO:0044615; GO GO:0005730; GO GO:0032391; GO GO:0070390; GO GO:0005509; GO GO:0031683; GO GO:0008017; GO GO:0007049; GO GO:0051301; GO GO:0051028; GO GO:0015031; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MSLALRGELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDQAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGK SQ ITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFI SQ AIMTGDI //