ID O35710; PN Nocturnin; GN Noct; OS 10090; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm {ECO:0000269|PubMed:23449310}. Nucleus {ECO:0000269|PubMed:23449310}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:20498072}. Mitochondrion {ECO:0000250|UniProtKB:Q9UK39}. DR UNIPROT: O35710; DR UNIPROT: Q9QZG9; DR Pfam: PF03372; DE Function: Phosphatase which catalyzes the conversion of NADP(+) to NAD(+) and of NADPH to NADH (By similarity). Shows a small preference for NADPH over NADP(+) (By similarity). Represses translation and promotes degradation of target mRNA molecules (By similarity). Plays an important role in post-transcriptional regulation of metabolic genes under circadian control (PubMed:20685873, PubMed:20498072). Exerts a rhythmic post-transcriptional control of genes necessary for metabolic functions including nutrient absorption, glucose/insulin sensitivity, lipid metabolism, adipogenesis, inflammation and osteogenesis (PubMed:20498072, PubMed:22082366, PubMed:21820310, PubMed:22073225, PubMed:22331129). Plays an important role in favoring adipogenesis over osteoblastogenesis and acts as a key regulator of the adipogenesis/osteogenesis balance (PubMed:20498072, PubMed:22082366). Promotes adipogenesis by facilitating PPARG nuclear translocation which activates its transcriptional activity (PubMed:20498072). Regulates circadian expression of NOS2 in the liver and negatively regulates the circadian expression of IGF1 in the bone (PubMed:22073225, PubMed:20685873). Critical for proper development of early embryos (PubMed:23449310). {ECO:0000250|UniProtKB:Q9UK39, ECO:0000269|PubMed:20498072, ECO:0000269|PubMed:20685873, ECO:0000269|PubMed:21820310, ECO:0000269|PubMed:22073225, ECO:0000269|PubMed:22082366, ECO:0000269|PubMed:22331129, ECO:0000269|PubMed:23449310}. DE Reference Proteome: Yes; DE Interaction: P37238; IntAct: EBI-15856114; Score: 0.40 GO GO:0005737; GO GO:0005739; GO GO:0005634; GO GO:0000932; GO GO:0048471; GO GO:0000175; GO GO:0046872; GO GO:0003729; GO GO:0019178; GO GO:0102757; GO GO:0004535; GO GO:0032922; GO GO:0007623; GO GO:0000290; GO GO:0048255; GO GO:0006739; GO GO:0010629; GO GO:0045668; GO GO:0033962; GO GO:0045600; GO GO:0042752; GO GO:0045995; GO GO:0009991; GO GO:0032496; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MYQSPRRLCSALLLRDAPGLRRTLVPGPRRTLAPPVLGSRPKSPQLQAAAASGAARSRPRTVSSMGNGTSRLYSALAKTV SQ NSSAAAQHPEYLVSTDPEHLEPIDPKELLEECRAVLHTRPPRYQRDFVDLRTDCSSSHSPIRVMQWNILAQALGEGKDNF SQ VQCPVEALKWEERKCLILEEILAYQPDILCLQEVDHYFDTFQPLLSRLGYQGTFFPKPWSPCLDVEHNNGPDGCALFFLQ SQ NRFKLISSTNIRLTAMTLKTNQVAIAQTLECKESGRQFCIAVTHLKARTGWERFRSAQGCDLLQNLQNITQGAKIPLIVC SQ GDFNAEPTEEVYKHFASSSLNLNSAYKLLSPDGQSEPPYTTWKIRTSGECRHTLDYIWYSRHALSVTSALDLLTEEQIGP SQ NRLPSFHYPSDHLSLVCDFSFNEEPHELF //