ID O42446; PN Deoxyribonuclease-1; GN dnase1; OS 8127; SL Nucleus Position: SL-0178; SL Comments: Secreted {ECO:0000250|UniProtKB:P24855}. Zymogen granule {ECO:0000250|UniProtKB:P24855}. Nucleus envelope {ECO:0000250|UniProtKB:P24855}. Note=Secretory protein, stored in zymogen granules and found in the nuclear envelope. {ECO:0000250|UniProtKB:P24855}. DR UNIPROT: O42446; DR Pfam: PF03372; DR PROSITE: PS00919; DR PROSITE: PS00918; DE Function: Serum endocuclease secreted into body fluids by a wide variety of exocrine and endocrine organs (PubMed:9395327). Expressed by non-hematopoietic tissues and preferentially cleaves protein-free DNA (By similarity). Among other functions, seems to be involved in cell death by apoptosis (By similarity). Binds specifically to G-actin and blocks actin polymerization. Preferentially attacks double-stranded DNA and produces oligonucleotides with 5'-phospho and 3'-hydroxy termini (PubMed:9395327). {ECO:0000250|UniProtKB:P21704, ECO:0000269|PubMed:9395327}. DE Reference Proteome: No; GO GO:0005576; GO GO:0005635; GO GO:0042588; GO GO:0004530; GO GO:0000737; GO GO:0002283; GO GO:0002673; GO GO:0070948; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MQTYRSRMHLVCSLGLFLTLLHLSNSLLLGAFNIKSFGDTKASNATLMNIITKIVKRYDVILIQEVRDSDLSATQTLMNY SQ VNKDSPQYKYIVSEPLGASTYKERYLFLYREALVSVVKSYTYDDGPEETGQDTFSREPFVVMFSSKNTAVRDFTLIPQHT SQ SPDLAVRELNALYDVVLDVRARWNTNDIVLLGDFNAGCSYVSGSAWQQIRIFTDKTFHWLITDAADTTVSQTVCPYDRIV SQ VTTDMMRGVVQNSAKVYNYMTDLNLKQDLALAVSDHFPVEVKLS //