ID O43310; PN CBP80/20-dependent translation initiation factor; GN CTIF; OS 9606; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, perinuclear region {ECO:0000269|PubMed:19648179}. DR UNIPROT: O43310; DR UNIPROT: B3KTR8; DR UNIPROT: Q8IVD5; DR Pfam: PF02854; DR OMIM: 613178; DR DisGeNET: 9811; DE Function: Specifically required for the pioneer round of mRNA translation mediated by the cap-binding complex (CBC), that takes place during or right after mRNA export via the nuclear pore complex (NPC). Acts via its interaction with the NCBP1/CBP80 component of the CBC complex and recruits the 40S small subunit of the ribosome via eIF3. In contrast, it is not involved in steady state translation, that takes place when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. Also required for nonsense-mediated mRNA decay (NMD), the pioneer round of mRNA translation mediated by the cap-binding complex playing a central role in nonsense-mediated mRNA decay (NMD). {ECO:0000269|PubMed:19648179}. DE Reference Proteome: Yes; DE Interaction: A0A2U2H131; IntAct: EBI-2866199; Score: 0.00 DE Interaction: Q86VS8; IntAct: EBI-24326289; Score: 0.56 DE Interaction: Q9NZD8; IntAct: EBI-24333116; Score: 0.56 DE Interaction: Q96MH2; IntAct: EBI-24352467; Score: 0.56 DE Interaction: Q6P9E2; IntAct: EBI-24373771; Score: 0.56 DE Interaction: Q9NUU7; IntAct: EBI-24377593; Score: 0.67 DE Interaction: A9UHW6; IntAct: EBI-24392534; Score: 0.56 DE Interaction: Q8N5M1; IntAct: EBI-24400192; Score: 0.56 DE Interaction: Q9UMR2; IntAct: EBI-25260673; Score: 0.56 GO GO:0005829; GO GO:0048471; GO GO:0003723; GO GO:0008494; GO GO:0000184; GO GO:0006446; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MENSSAASASSEAGSSRSQEIEELERFIDSYVLEYQVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRA SQ PPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLPHIDREGCGKGKLEDGDGINLND SQ IEKVLPAWQGYHPMPHEVEIAHTKKLFRRRRNDRRRQQRPPGGNKPQQHGDHQPGSAKHNRDHQKSYQGGSAPHPSGRPT SQ HHGYSQNRRWHHGNMKHPPGDKGEAGAHRNAKETMTIENPKLEDTAGDTGHSSLEAPRSPDTLAPVASERLPPQQSGGPE SQ VETKRKDSILPERIGERPKITLLQSSKDRLRRRLKEKDEVAVETTTPQQNKMDKLIEILNSMRNNSSDVDTKLTTFMEEA SQ QNSTNSEEMLGEIVRTIYQKAVSDRSFAFTAAKLCDKMALFMVEGTKFRSLLLNMLQKDFTVREELQQQDVERWLGFITF SQ LCEVFGTMRSSTGEPFRVLVCPIYTCLRELLQSQDVKEDAVLCCSMELQSTGRLLEEQLPEMMTELLASARDKMLCPSES SQ MLTRSLLLEVIELHANSWNPLTPPITQYYNRTIQKLTA //