ID  O54962;
PN  Barrier-to-autointegration factor, N-terminally processed;
GN  Banf1;
OS  10090;
SL  Nucleus Position: SL-0178;
SL  Comments: Nucleus {ECO:0000250|UniProtKB:O75531}. Chromosome {ECO:0000250|UniProtKB:O75531}. Nucleus envelope {ECO:0000250|UniProtKB:O75531}. Cytoplasm {ECO:0000250|UniProtKB:O75531}. Note=Significantly enriched at the nuclear inner membrane, diffusely throughout the nucleus during interphase and concentrated at the chromosomes during the M-phase. The phosphorylated form (by VRK1) shows a cytoplasmic localization whereas the unphosphorylated form locates almost exclusively in the nucleus. May be included in HIV-1 virions via its interaction with viral GAG polyprotein. {ECO:0000250|UniProtKB:O75531}.
DR  UNIPROT: O54962;
DR  UNIPROT: Q542E6;
DR  Pfam: PF02961;
DE  Function: Non-specific DNA-binding protein that plays key roles in mitotic nuclear reassembly, chromatin organization, DNA damage response, gene expression and intrinsic immunity against foreign DNA (By similarity). Contains two non-specific double-stranded DNA (dsDNA)- binding sites which promote DNA cross-bridging (By similarity). Plays a key role in nuclear membrane reformation at the end of mitosis by driving formation of a single nucleus in a spindle-independent manner (By similarity). Transiently cross-bridges anaphase chromosomes via its ability to bridge distant DNA sites, leading to the formation of a dense chromatin network at the chromosome ensemble surface that limits membranes to the surface (By similarity). Also acts as a negative regulator of innate immune activation by restricting CGAS activity toward self-DNA upon acute loss of nuclear membrane integrity (PubMed:32156810). Outcompetes CGAS for DNA-binding, thereby preventing CGAS activation and subsequent damaging autoinflammatory responses (By similarity). Also involved in DNA damage response: interacts with PARP1 in response to oxidative stress, thereby inhibiting the ADP- ribosyltransferase activity of PARP1 (By similarity). Involved in the recognition of exogenous dsDNA in the cytosol: associates with exogenous dsDNA immediately after its appearance in the cytosol at endosome breakdown and is required to avoid autophagy (By similarity). {ECO:0000250|UniProtKB:O75531, ECO:0000269|PubMed:32156810}.
DE  Reference Proteome: Yes;
DE  Interaction: P68510; IntAct: EBI-8586548; Score: 0.35
DE  Interaction: P52927; IntAct: EBI-9986179; Score: 0.35
DE  Interaction: Q8VI24; IntAct: EBI-26885060; Score: 0.35
GO  GO:0000785;
GO  GO:0000793;
GO  GO:0005737;
GO  GO:0005829;
GO  GO:0005635;
GO  GO:0005654;
GO  GO:0005634;
GO  GO:0003677;
GO  GO:0003690;
GO  GO:0019899;
GO  GO:0042802;
GO  GO:0097726;
GO  GO:0008022;
GO  GO:0042803;
GO  GO:0047485;
GO  GO:0006325;
GO  GO:0030261;
GO  GO:0007059;
GO  GO:0015074;
GO  GO:0075713;
GO  GO:0007084;
GO  GO:0045824;
GO  GO:0010836;
GO  GO:0032480;
GO  GO:0045071;
GO  GO:0006979;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MTTSQKHRDFVAEPMGEKPVGSLAGIGDVLSKRLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC
SQ  LREWCDAFL
//