ID  O57686;
PN  Small ubiquitin-related modifier 1-A;
GN  sumo1;
OS  8355;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0182;
SL  Comments: Nucleus membrane {ECO:0000250|UniProtKB:P63165}. Nucleus speckle {ECO:0000250|UniProtKB:P63166}. Cytoplasm {ECO:0000250|UniProtKB:P63165}. Nucleus, PML body {ECO:0000250|UniProtKB:P63165}. Cell membrane {ECO:0000250|UniProtKB:P63165}. Nucleus {ECO:0000250|UniProtKB:P63165}.
DR  UNIPROT: O57686;
DR  Pfam: PF11976;
DR  PROSITE: PS50053;
DE  Function: Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer (PubMed:9427648). Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex sae1-sae2 and linkage to the E2 enzyme ube2i. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric sumo1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins (By similarity). {ECO:0000250|UniProtKB:P63165, ECO:0000269|PubMed:9427648}.
DE  Reference Proteome: Yes;
GO  GO:0005737;
GO  GO:0031965;
GO  GO:0016607;
GO  GO:0097165;
GO  GO:0005886;
GO  GO:0016605;
GO  GO:0008134;
GO  GO:0071276;
GO  GO:0034605;
GO  GO:0016925;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MSDQEAKPSSEDLGDKKDGGDYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYRQRQGVPMNSLRFLFEGQRISDHQTPKE
SQ  LGMEEEDVIEVYQEQTGGHSTF
//