ID O64629; PN Serine/threonine-protein kinase Aurora-3; GN AUR3; OS 3702; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, perinuclear region. Nucleus. Chromosome. Chromosome, centromere. Note=Cytoplasmic perinuclear region or in dots around the nucleolus and at the nuclear periphery in interphase cells, associated to centromeric regions of condensed chromosomes at metaphase and dispersed along the entire length of the chromosomes during anaphase (PubMed:16028112). Nucleus (PubMed:15722465). {ECO:0000269|PubMed:15722465, ECO:0000269|PubMed:16028112}. DR UNIPROT: O64629; DR Pfam: PF00069; DR PROSITE: PS00107; DR PROSITE: PS50011; DR PROSITE: PS00108; DE Function: Phosphorylates in vitro histone H3 at 'Ser-10' (H3S10ph) and 'Ser-28' (H3S28ph), but not at 'Thr-3' (H3T3ph) or 'Thr-11' (H3T11ph). Colocalizes with phosphorylated histone H3 during mitosis. Associates with cytoskeletal structures that are necessary for cytokinesis and with the microtubule spindle. {ECO:0000269|PubMed:16028112, ECO:0000269|PubMed:17087760}. DE Reference Proteome: Yes; GO GO:0032133; GO GO:0000775; GO GO:0005634; GO GO:0048471; GO GO:0005819; GO GO:0005876; GO GO:0051233; GO GO:0005524; GO GO:0035175; GO GO:0044022; GO GO:0035174; GO GO:0106310; GO GO:0007059; GO GO:0007052; GO GO:0016310; GO GO:0006468; GO GO:0032465; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MSKKSTESDAGNTEKQWSLADFEIGRPLGKGKFGRVYLAREAKSKYIVALKVIFKEQIEKYKIHHQLRREMEIQTSLRHP SQ NILRLFGWFHDNERIFLILEYAHGGELYGVLKQNGHLTEQQAATYIASLSQALAYCHGKCVIHRDIKPENLLLDHEGRLK SQ IADFGWSVQSSNKRKTMCGTLDYLAPEMVENRDHDYAVDNWTLGILCYEFLYGNPPFEAESQKDTFKRILKIDLSFPLTP SQ NVSEEAKNLISQLLVKDPSKRLSIEKIMQHPWIVKNADPKGVCASIDI //