ID O70146; PN Dual specificity testis-specific protein kinase 1; GN Tesk1; OS 10090; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm {ECO:0000250|UniProtKB:Q15569}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q63572}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000250|UniProtKB:Q15569}. Cell projection, lamellipodium {ECO:0000250|UniProtKB:Q63572}. Note=Colocalizes with SPRY4 in vesicular spots in the cytoplasm (By similarity). Localized to F-actin- rich lamellipodia at the cell periphery following fibronectin-mediated cell adhesion of Schwann cells (By similarity). {ECO:0000250|UniProtKB:Q15569, ECO:0000250|UniProtKB:Q63572}. DR UNIPROT: O70146; DR UNIPROT: O70147; DR UNIPROT: Q499W7; DR Pfam: PF07714; DR PROSITE: PS00107; DR PROSITE: PS50011; DR PROSITE: PS00109; DE Function: Dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues (By similarity). Regulates the cellular cytoskeleton by enhancing actin stress fiber formation via phosphorylation of cofilin and by preventing microtubule breakdown via inhibition of TAOK1/MARKK kinase activity (By similarity). Inhibits podocyte motility via regulation of actin cytoskeletal dynamics and phosphorylation of CFL1 (PubMed:30115939). Positively regulates integrin-mediated cell spreading, via phosphorylation of cofilin (By similarity). Suppresses ciliogenesis via multiple pathways; phosphorylation of CFL1, suppression of ciliary vesicle directional trafficking to the ciliary base, and by facilitating YAP1 nuclear localization where it acts as a transcriptional corepressor of the TEAD4 target genes AURKA and PLK1 (By similarity). Probably plays a central role at and after the meiotic phase of spermatogenesis (By similarity). {ECO:0000250|UniProtKB:Q15569, ECO:0000250|UniProtKB:Q63572, ECO:0000269|PubMed:30115939}. DE Reference Proteome: Yes; GO GO:0005813; GO GO:0005737; GO GO:0031410; GO GO:0030027; GO GO:0005634; GO GO:0048471; GO GO:0005524; GO GO:0046872; GO GO:0008022; GO GO:0004672; GO GO:0019901; GO GO:0106310; GO GO:0004674; GO GO:0004712; GO GO:0004713; GO GO:0030036; GO GO:0051650; GO GO:1902018; GO GO:0042326; GO GO:0031953; GO GO:0071901; GO GO:0090521; GO GO:1900182; GO GO:0001934; GO GO:0051496; GO GO:1900026; GO GO:0032956; GO GO:0032880; GO GO:0007283; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MAGERPPLRGPGPGEAPGEGPGGAGGGPGRGRPSSYRALRSAVSSLARVDDFDCAEKIGAGFFSEVYKVRHRQSGQVMVL SQ KMNKLPSNRSNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIAQGLRY SQ LHAKGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEKIPVYREGTRKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGI SQ VLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGNDCPLPFLLLAIHCCSMEPSTRAPFTEITQHLEQILEQQPEATPLA SQ KPPLTKAPLTYNQGSVPRGGPSATLPRPDPRLSRSRSDLFLPPSPESPPSWGDNLTRVNPFSLREDLRGGKIKLLDTPCK SQ PATPLPLVPPSPLTSTQLPLVTTPDILVQPETPVRRCRSLPSSPELPRRMETALPGPGPSPMGPTEERMDCEGSSPEPEP SQ PGLAPQLPLAVATDNFISTCSSASQPWSPRSGPPLNNNPPAVVVNSPQGWAREPWNRAQHSLPRAAALERTEPSPPPSAP SQ REPEEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPSLQLPGARS //