ID O77821; PN Acyl-protein thioesterase 1; GN LYPLA1; OS 9986; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Cytoplasm {ECO:0000250|UniProtKB:O75608}. Cell membrane {ECO:0000250|UniProtKB:O75608}. Nucleus membrane {ECO:0000250|UniProtKB:O75608}. Endoplasmic reticulum {ECO:0000250|UniProtKB:O75608}. Note=Shows predominantly a cytoplasmic localization with a weak expression in the cell membrane, nuclear membrane and endoplasmic reticulum. {ECO:0000250|UniProtKB:O75608}. DR UNIPROT: O77821; DR Pfam: PF02230; DE Function: Acts as a acyl-protein thioesterase hydrolyzing fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS (By similarity). Has depalmitoylating activity toward KCNMA1 (By similarity). Could also depalmitoylate ADRB2 (By similarity). Acts as a lysophospholipase hydrolyzing various lysophospholipids including lysophosphatidylcholine (lyso-PC), lysophosphatidylethanolamine (lyso-PE), lysophosphatidylinositol (lyso- PI) and lysophosphatidylserine (lyso-PS) (By similarity). Has much higher thioesterase activity than lysophospholipase activity (By similarity). Contributes to the production of lysophosphatidic acid (LPA) during blood coagulation by recognizing and cleaving plasma phospholipids to generate lysophospholipids which in turn act as substrates for ENPP2 to produce LPA (By similarity). {ECO:0000250|UniProtKB:O75608, ECO:0000250|UniProtKB:P70470}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0005783; GO GO:0031965; GO GO:0005886; GO GO:0004622; GO GO:0008474; GO GO:0004620; GO GO:0006631; GO GO:0002084; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSP SQ DSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSA SQ NRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID //