ID O88984; PN Nuclear RNA export factor 1; GN Nxf1; OS 10116; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0185; SL Comments: Nucleus, nucleoplasm {ECO:0000250|UniProtKB:Q9UBU9}. Nucleus speckle {ECO:0000250|UniProtKB:Q9UBU9}. Nucleus, nuclear pore complex {ECO:0000250|UniProtKB:Q9UBU9}. Nucleus envelope {ECO:0000250|UniProtKB:Q9UBU9}. Cytoplasm {ECO:0000250|UniProtKB:Q9UBU9}. Cytoplasm, Stress granule {ECO:0000250|UniProtKB:Q9UBU9}. Note=Localized predominantly in the nucleoplasm and at both the nucleoplasmic and cytoplasmic faces of the nuclear pore complex. Shuttles between the nucleus and the cytoplasm. Travels to the cytoplasm as part of the exon junction complex (EJC) bound to mRNA. The association with the TREX complex seems to occur in regions surrounding nuclear speckles known as perispeckles. Nucleus; nuclear rim. {ECO:0000250|UniProtKB:Q9UBU9}. DR UNIPROT: O88984; DR Pfam: PF02136; DR Pfam: PF09162; DR Pfam: PF03943; DR PROSITE: PS51450; DR PROSITE: PS50177; DR PROSITE: PS51281; DE Function: Involved in the nuclear export of mRNA species bearing retroviral constitutive transport elements (CTE) and in the export of mRNA from the nucleus to the cytoplasm (TAP/NFX1 pathway). The NXF1- NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with ALYREF/THOC4 and THOC5 components of the TREX complex. ALYREF/THOC4-bound mRNA is thought to be transferred to the NXF1-NXT1 heterodimer for export. Also involved in nuclear export of m6A- containing mRNAs: interaction between SRSF3 and YTHDC1 facilitates m6A- containing mRNA-binding to both SRSF3 and NXF1, promoting mRNA nuclear export. {ECO:0000250|UniProtKB:Q9UBU9}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0010494; GO GO:0042405; GO GO:0005643; GO GO:0042272; GO GO:0016607; GO GO:0005634; GO GO:0003729; GO GO:0003723; GO GO:0006406; GO GO:0016973; GO GO:0015031; GO GO:0006405; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MADEGKSYNEHDDRVSFPQRRKKGRGPFRWKCGVGNRRSGRGGSGIRSSRFEEDDGDVAMNDPQDGPRVRFNPYTTRPNR SQ RRDTWHDRDRIHVTVRRDRAPQERGGAGTSQDGTTKNWFKITIPYGKKYDKMWLLSMIQSKCSVPFNPIEFHYENTRAHF SQ FVENATTASALKAVNYKIQDRENGRISIIINSSAPPYIVQNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQ SQ NIDVVLNRRGCMAAALRIIEENIPELLSLNLSNNRLYKLDDMSSIVQKAPNLKILNLSGNELKSEWELDKIKGLKLEELW SQ LDRNPMCDTFLDQSTYISTIRERFPKLLRLDGHELPPPIAFDVEAPTMLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSG SQ DRQGLLDAYHDGACCSLSTPSNPQNPVRHNLAKYFNDSRNVKKIKDTTTRFRLLKHTRLNVVAFLNELPKTHHDVNSFVV SQ DISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASPEEIQRAFAMPAPTPSSSPVP SQ TLSQEQQDMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK //