ID O94756; PN Meiotic expression up-regulated protein 14; GN meu14; OS 284812; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body {ECO:0000269|PubMed:12759375}. Nucleus membrane {ECO:0000269|PubMed:12759375}; Peripheral membrane protein {ECO:0000269|PubMed:12759375}; Cytoplasmic side {ECO:0000269|PubMed:12759375}. Prospore membrane {ECO:0000269|PubMed:12759375}. DR UNIPROT: O94756; DR Pfam: PF13805; DE Function: Has a role in nuclear division during meiosis II where it stabilizes the proper segregation of the spindle pole bodies. Also has a role in the formation and extension of the forespore membrane. {ECO:0000269|PubMed:12759375}. DE Reference Proteome: Yes; GO GO:0036286; GO GO:0035974; GO GO:0031965; GO GO:0005886; GO GO:0070056; GO GO:0070057; GO GO:0008289; GO GO:0031322; GO GO:0070941; GO GO:0006897; GO GO:0140043; GO GO:0006469; TP Membrane Topology: Peripheral; Source: UniProt - Experimental Evidence {ECO:0000269|PubMed:12759375}; SQ MPKSSNLKMQRKGSLRENGLVKGLNKNKFSISKLKELSHADDSRKSHRIIRSGKSSGEAYKQAGKGLMNLGNHLSDWGAK SQ SSNLSLNDISDKIGVLVSELGETEIEFVKAFNENRIKFKAIRAMEDSIAPSRAHRQRLISSIEREEERDPLSPKLTDLQN SQ QLVRTEAENLVGEMQLDNTSREVFKSSFQGLMDAFQLRAQKQMTLSYYASQLAELINDEVAYPGDNPAAYSQKYATQIMH SQ QCVESMARLLAPVTSETTEHVGSDCEFTRKSSSSVEFSDHSQDSGDPSQQNILQVKNVQAVLSIPEAESYKAQLLSSIAE SQ EQKKKELQAKSTVFL //