ID  P00519;
PN  Tyrosine-protein kinase ABL1;
GN  ABL1;
OS  9606;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0182;
SL  Comments: Cytoplasm, cytoskeleton. Nucleus. Mitochondrion {ECO:0000250}. Note=Shuttles between the nucleus and cytoplasm depending on environmental signals. Sequestered into the cytoplasm through interaction with 14-3-3 proteins. Localizes to mitochondria in response to oxidative stress (By similarity). {ECO:0000250}. [Isoform IB]: Nucleus membrane; Lipid-anchor. Note=The myristoylated c-ABL protein is reported to be nuclear.
DR  UNIPROT: P00519;
DR  UNIPROT: A3KFJ3;
DR  UNIPROT: Q13869;
DR  UNIPROT: Q13870;
DR  UNIPROT: Q16133;
DR  UNIPROT: Q17R61;
DR  UNIPROT: Q45F09;
DR  PDB: 1AB2;
DR  PDB: 1AWO;
DR  PDB: 1BBZ;
DR  PDB: 1JU5;
DR  PDB: 1OPL;
DR  PDB: 1ZZP;
DR  PDB: 2ABL;
DR  PDB: 2E2B;
DR  PDB: 2F4J;
DR  PDB: 2FO0;
DR  PDB: 2G1T;
DR  PDB: 2G2F;
DR  PDB: 2G2H;
DR  PDB: 2G2I;
DR  PDB: 2GQG;
DR  PDB: 2HIW;
DR  PDB: 2HYY;
DR  PDB: 2HZ0;
DR  PDB: 2HZ4;
DR  PDB: 2HZI;
DR  PDB: 2O88;
DR  PDB: 2V7A;
DR  PDB: 3CS9;
DR  PDB: 3EG0;
DR  PDB: 3EG1;
DR  PDB: 3EG2;
DR  PDB: 3EG3;
DR  PDB: 3EGU;
DR  PDB: 3K2M;
DR  PDB: 3PYY;
DR  PDB: 3QRI;
DR  PDB: 3QRJ;
DR  PDB: 3QRK;
DR  PDB: 3T04;
DR  PDB: 3UE4;
DR  PDB: 3UYO;
DR  PDB: 4J9B;
DR  PDB: 4J9C;
DR  PDB: 4J9D;
DR  PDB: 4J9E;
DR  PDB: 4J9F;
DR  PDB: 4J9G;
DR  PDB: 4J9H;
DR  PDB: 4J9I;
DR  PDB: 4JJB;
DR  PDB: 4JJC;
DR  PDB: 4JJD;
DR  PDB: 4TWP;
DR  PDB: 4WA9;
DR  PDB: 4XEY;
DR  PDB: 4YC8;
DR  PDB: 4ZOG;
DR  PDB: 5DC0;
DR  PDB: 5DC4;
DR  PDB: 5DC9;
DR  PDB: 5HU9;
DR  PDB: 5MO4;
DR  PDB: 5NP2;
DR  PDB: 5OAZ;
DR  PDB: 6AMV;
DR  PDB: 6AMW;
DR  PDB: 6BL8;
DR  PDB: 6NPE;
DR  PDB: 6NPU;
DR  PDB: 6NPV;
DR  PDB: 6XR6;
DR  PDB: 6XR7;
DR  PDB: 6XRG;
DR  PDB: 7CC2;
DR  PDB: 7DT2;
DR  Pfam: PF08919;
DR  Pfam: PF07714;
DR  Pfam: PF00017;
DR  Pfam: PF00018;
DR  PROSITE: PS00107;
DR  PROSITE: PS50011;
DR  PROSITE: PS00109;
DR  PROSITE: PS50001;
DR  PROSITE: PS50002;
DR  OMIM: 189980;
DR  OMIM: 608232;
DR  OMIM: 617602;
DR  DisGeNET: 25;
DE  Function: Non-receptor tyrosine-protein kinase that plays a role in many key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion, receptor endocytosis, autophagy, DNA damage response and apoptosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like WASF3 (involved in branch formation); ANXA1 (involved in membrane anchoring); DBN1, DBNL, CTTN, RAPH1 and ENAH (involved in signaling); or MAPT and PXN (microtubule-binding proteins). Phosphorylation of WASF3 is critical for the stimulation of lamellipodia formation and cell migration. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as BCAR1, CRK, CRKL, DOK1, EFS or NEDD9 (PubMed:22810897). Phosphorylates multiple receptor tyrosine kinases and more particularly promotes endocytosis of EGFR, facilitates the formation of neuromuscular synapses through MUSK, inhibits PDGFRB-mediated chemotaxis and modulates the endocytosis of activated B-cell receptor complexes. Other substrates which are involved in endocytosis regulation are the caveolin (CAV1) and RIN1. Moreover, ABL1 regulates the CBL family of ubiquitin ligases that drive receptor down-regulation and actin remodeling. Phosphorylation of CBL leads to increased EGFR stability. Involved in late-stage autophagy by regulating positively the trafficking and function of lysosomal components. ABL1 targets to mitochondria in response to oxidative stress and thereby mediates mitochondrial dysfunction and cell death. In response to oxidative stress, phosphorylates serine/threonine kinase PRKD2 at 'Tyr-717' (PubMed:28428613). ABL1 is also translocated in the nucleus where it has DNA-binding activity and is involved in DNA-damage response and apoptosis. Many substrates are known mediators of DNA repair: DDB1, DDB2, ERCC3, ERCC6, RAD9A, RAD51, RAD52 or WRN. Activates the proapoptotic pathway when the DNA damage is too severe to be repaired. Phosphorylates TP73, a primary regulator for this type of damage- induced apoptosis. Phosphorylates the caspase CASP9 on 'Tyr-153' and regulates its processing in the apoptotic response to DNA damage. Phosphorylates PSMA7 that leads to an inhibition of proteasomal activity and cell cycle transition blocks. ABL1 acts also as a regulator of multiple pathological signaling cascades during infection. Several known tyrosine-phosphorylated microbial proteins have been identified as ABL1 substrates. This is the case of A36R of Vaccinia virus, Tir (translocated intimin receptor) of pathogenic E.coli and possibly Citrobacter, CagA (cytotoxin-associated gene A) of H.pylori, or AnkA (ankyrin repeat-containing protein A) of A.phagocytophilum. Pathogens can highjack ABL1 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1. Regulates T-cell differentiation in a TBX21-dependent manner (By similarity). Positively regulates chemokine-mediated T-cell migration, polarization, and homing to lymph nodes and immune-challenged tissues, potentially via activation of NEDD9/HEF1 and RAP1 (By similarity). Phosphorylates TBX21 on tyrosine residues leading to an enhancement of its transcriptional activator activity (By similarity). {ECO:0000250|UniProtKB:P00520, ECO:0000269|PubMed:10391250, ECO:0000269|PubMed:11971963, ECO:0000269|PubMed:12379650, ECO:0000269|PubMed:12531427, ECO:0000269|PubMed:12672821, ECO:0000269|PubMed:15031292, ECO:0000269|PubMed:15556646, ECO:0000269|PubMed:15657060, ECO:0000269|PubMed:15886098, ECO:0000269|PubMed:16424036, ECO:0000269|PubMed:16678104, ECO:0000269|PubMed:16943190, ECO:0000269|PubMed:17306540, ECO:0000269|PubMed:17623672, ECO:0000269|PubMed:18328268, ECO:0000269|PubMed:18945674, ECO:0000269|PubMed:19891780, ECO:0000269|PubMed:20357770, ECO:0000269|PubMed:20417104, ECO:0000269|PubMed:22810897, ECO:0000269|PubMed:28428613, ECO:0000269|PubMed:9037071, ECO:0000269|PubMed:9144171, ECO:0000269|PubMed:9461559}.
DE  Disease: Leukemia, chronic myeloid (CML) [MIM:608232]: A clonal myeloproliferative disorder of a pluripotent stem cell with a specific cytogenetic abnormality, the Philadelphia chromosome (Ph), involving myeloid, erythroid, megakaryocytic, B-lymphoid, and sometimes T- lymphoid cells, but not marrow fibroblasts. Note=The gene represented in this entry is involved in disease pathogenesis. Note=A chromosomal aberration involving ABL1 has been found in patients with chronic myeloid leukemia. Translocation t(9;22)(q34;q11) with BCR. The translocation produces a BCR-ABL found also in acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL). {ECO:0000269|PubMed:3021337}. Note=A chromosomal aberration involving ABL1 is found in a form of acute lymphoblastic leukemia (PubMed:15361874). Translocation t(9;9)(q34;q34) with NUP214 (PubMed:15361874). {ECO:0000269|PubMed:15361874}. Congenital heart defects and skeletal malformations syndrome (CHDSKM) [MIM:617602]: An autosomal dominant disorder characterized by congenital heart disease with atrial and ventricular septal defects, variable skeletal abnormalities, and failure to thrive. Skeletal defects include pectus excavatum, scoliosis, and finger contractures. Some patient exhibit joint laxity. {ECO:0000269|PubMed:28288113}. Note=The disease is caused by variants affecting the gene represented in this entry.
DE  Reference Proteome: Yes;
DE  Interaction: Q92558; IntAct: EBI-7380789; Score: 0.57
DE  Interaction: P08631; IntAct: EBI-7296396; Score: 0.40
DE  Interaction: P05067; IntAct: EBI-7810061; Score: 0.35
DE  Interaction: Q9XSK8; IntAct: EBI-7047340; Score: 0.31
DE  Interaction: Q8CBW3; IntAct: EBI-375573; Score: 0.40
DE  Interaction: Q8IZP0; IntAct: EBI-375643; Score: 0.90
DE  Interaction: P22681; IntAct: EBI-7392045; Score: 0.31
DE  Interaction: P62258; IntAct: EBI-593829; Score: 0.53
DE  Interaction: P31946; IntAct: EBI-593829; Score: 0.53
DE  Interaction: P63104; IntAct: EBI-593829; Score: 0.62
DE  Interaction: P31947; IntAct: EBI-593829; Score: 0.50
DE  Interaction: P61981; IntAct: EBI-593829; Score: 0.74
DE  Interaction: Q04917; IntAct: EBI-593829; Score: 0.64
DE  Interaction: Q9BX66; IntAct: EBI-624110; Score: 0.52
DE  Interaction: Q15303; IntAct: EBI-7872165; Score: 0.44
DE  Interaction: P04626; IntAct: EBI-7881352; Score: 0.44
DE  Interaction: P00533; IntAct: EBI-7887814; Score: 0.69
DE  Interaction: P21860; IntAct: EBI-7896542; Score: 0.44
DE  Interaction: Q05655; IntAct: EBI-8488876; Score: 0.40
DE  Interaction: Q07817; IntAct: EBI-8488890; Score: 0.40
DE  Interaction: P78524; IntAct: EBI-962642; Score: 0.40
DE  Interaction: Q09472; IntAct: EBI-8504608; Score: 0.27
DE  Interaction: O60504; IntAct: EBI-8565293; Score: 0.54
DE  Interaction: P15941; IntAct: EBI-8597680; Score: 0.66
DE  Interaction: Q13315; IntAct: EBI-1005980; Score: 0.70
DE  Interaction: P54274; IntAct: EBI-1005991; Score: 0.40
DE  Interaction: Q13671; IntAct: EBI-1102754; Score: 0.61
DE  Interaction: O15350; IntAct: EBI-7807114; Score: 0.40
DE  Interaction: Q9NYB9; IntAct: EBI-7088267; Score: 0.52
DE  Interaction: Q63767; IntAct: EBI-1176858; Score: 0.44
DE  Interaction: P12931; IntAct: EBI-7286298; Score: 0.59
DE  Interaction: P35222; IntAct: EBI-7286271; Score: 0.54
DE  Interaction: O43900; IntAct: EBI-1957060; Score: 0.40
DE  Interaction: Q9HCM9; IntAct: EBI-1957076; Score: 0.40
DE  Interaction: Q9Y697; IntAct: EBI-1957120; Score: 0.40
DE  Interaction: Q92918; IntAct: EBI-1957132; Score: 0.57
DE  Interaction: P78345; IntAct: EBI-1957144; Score: 0.40
DE  Interaction: Q8NFP9; IntAct: EBI-1957156; Score: 0.40
DE  Interaction: O43390; IntAct: EBI-1957168; Score: 0.40
DE  Interaction: O00254; IntAct: EBI-1957180; Score: 0.40
DE  Interaction: Q9Y5Y3; IntAct: EBI-1957192; Score: 0.40
DE  Interaction: Q9UL51; IntAct: EBI-1957204; Score: 0.40
DE  Interaction: P78357; IntAct: EBI-1957216; Score: 0.40
DE  Interaction: Q96NS5; IntAct: EBI-1957228; Score: 0.40
DE  Interaction: Q07890; IntAct: EBI-1957240; Score: 0.40
DE  Interaction: O94856; IntAct: EBI-1957252; Score: 0.40
DE  Interaction: Q9NZV5; IntAct: EBI-1957264; Score: 0.40
DE  Interaction: P49450; IntAct: EBI-1957276; Score: 0.40
DE  Interaction: Q92874; IntAct: EBI-1957288; Score: 0.40
DE  Interaction: Q7Z408; IntAct: EBI-1957319; Score: 0.40
DE  Interaction: P98161; IntAct: EBI-1957300; Score: 0.40
DE  Interaction: P43699; IntAct: EBI-1957331; Score: 0.40
DE  Interaction: P50570; IntAct: EBI-1957343; Score: 0.40
DE  Interaction: Q96GP6; IntAct: EBI-1957367; Score: 0.40
DE  Interaction: Q14315; IntAct: EBI-1957355; Score: 0.40
DE  Interaction: P31273; IntAct: EBI-1957391; Score: 0.40
DE  Interaction: Q92664; IntAct: EBI-1957379; Score: 0.40
DE  Interaction: Q9UJV9; IntAct: EBI-1957403; Score: 0.40
DE  Interaction: O43493; IntAct: EBI-1957415; Score: 0.40
DE  Interaction: Q15427; IntAct: EBI-1957427; Score: 0.40
DE  Interaction: Q12979; IntAct: EBI-1957439; Score: 0.40
DE  Interaction: Q13023; IntAct: EBI-1957451; Score: 0.40
DE  Interaction: P15586; IntAct: EBI-1957463; Score: 0.40
DE  Interaction: P23760; IntAct: EBI-1957487; Score: 0.40
DE  Interaction: Q9UIF9; IntAct: EBI-1957475; Score: 0.40
DE  Interaction: Q9UM47; IntAct: EBI-1957499; Score: 0.40
DE  Interaction: Q13415; IntAct: EBI-1957511; Score: 0.40
DE  Interaction: P06865; IntAct: EBI-1957523; Score: 0.40
DE  Interaction: Q9H2X0; IntAct: EBI-1957535; Score: 0.40
DE  Interaction: P51587; IntAct: EBI-1957563; Score: 0.40
DE  Interaction: Q9UMN6; IntAct: EBI-1957551; Score: 0.40
DE  Interaction: Q12947; IntAct: EBI-1957575; Score: 0.40
DE  Interaction: Q9BYB0; IntAct: EBI-1957587; Score: 0.40
DE  Interaction: Q9UBS5; IntAct: EBI-1957599; Score: 0.40
DE  Interaction: Q8IZD9; IntAct: EBI-1957611; Score: 0.40
DE  Interaction: P28340; IntAct: EBI-1957623; Score: 0.40
DE  Interaction: Q9NYQ7; IntAct: EBI-1957635; Score: 0.40
DE  Interaction: P78329; IntAct: EBI-1957659; Score: 0.40
DE  Interaction: O43708; IntAct: EBI-1957647; Score: 0.40
DE  Interaction: Q9H5I1; IntAct: EBI-1957671; Score: 0.40
DE  Interaction: P46013; IntAct: EBI-1957683; Score: 0.40
DE  Interaction: O76039; IntAct: EBI-1957707; Score: 0.40
DE  Interaction: Q14008; IntAct: EBI-1957719; Score: 0.40
DE  Interaction: Q13087; IntAct: EBI-1957755; Score: 0.40
DE  Interaction: O14513; IntAct: EBI-1957743; Score: 0.40
DE  Interaction: O95886; IntAct: EBI-1957767; Score: 0.40
DE  Interaction: Q9Y5X2; IntAct: EBI-1957793; Score: 0.40
DE  Interaction: P42566; IntAct: EBI-1957805; Score: 0.40
DE  Interaction: Q96RL7; IntAct: EBI-1957817; Score: 0.40
DE  Interaction: Q9UMY4; IntAct: EBI-1957829; Score: 0.40
DE  Interaction: Q9C0E4; IntAct: EBI-1957853; Score: 0.40
DE  Interaction: Q15036; IntAct: EBI-1957841; Score: 0.40
DE  Interaction: P34820; IntAct: EBI-1957877; Score: 0.40
DE  Interaction: P30260; IntAct: EBI-1957865; Score: 0.40
DE  Interaction: O75751; IntAct: EBI-1957889; Score: 0.40
DE  Interaction: Q86UR5; IntAct: EBI-1957906; Score: 0.40
DE  Interaction: Q9NZQ3; IntAct: EBI-1957930; Score: 0.40
DE  Interaction: P26992; IntAct: EBI-1957918; Score: 0.40
DE  Interaction: P50851; IntAct: EBI-1957942; Score: 0.40
DE  Interaction: O76081; IntAct: EBI-1957956; Score: 0.40
DE  Interaction: Q92988; IntAct: EBI-1957968; Score: 0.40
DE  Interaction: Q96PC5; IntAct: EBI-1957980; Score: 0.40
DE  Interaction: Q9BQ89; IntAct: EBI-1958016; Score: 0.40
DE  Interaction: P20810; IntAct: EBI-1957992; Score: 0.40
DE  Interaction: Q9H1R2; IntAct: EBI-1958004; Score: 0.40
DE  Interaction: P02765; IntAct: EBI-1958028; Score: 0.40
DE  Interaction: Q9Y3S1; IntAct: EBI-1958040; Score: 0.40
DE  Interaction: Q13905; IntAct: EBI-1958052; Score: 0.66
DE  Interaction: Q9UQ16; IntAct: EBI-1958064; Score: 0.40
DE  Interaction: Q9Y5K6; IntAct: EBI-1958076; Score: 0.40
DE  Interaction: O15255; IntAct: EBI-1958088; Score: 0.40
DE  Interaction: Q8TB24; IntAct: EBI-1958100; Score: 0.40
DE  Interaction: O95157; IntAct: EBI-1958112; Score: 0.40
DE  Interaction: O43281; IntAct: EBI-1958124; Score: 0.40
DE  Interaction: O15085; IntAct: EBI-1958148; Score: 0.40
DE  Interaction: P08047; IntAct: EBI-1958160; Score: 0.40
DE  Interaction: P98164; IntAct: EBI-1958172; Score: 0.40
DE  Interaction: Q86SG6; IntAct: EBI-1958184; Score: 0.40
DE  Interaction: Q9H0X9; IntAct: EBI-1958196; Score: 0.40
DE  Interaction: Q9NQC3; IntAct: EBI-1958208; Score: 0.40
DE  Interaction: O60244; IntAct: EBI-1958225; Score: 0.40
DE  Interaction: Q9UK85; IntAct: EBI-1958237; Score: 0.40
DE  Interaction: Q9BXM0; IntAct: EBI-1958249; Score: 0.40
DE  Interaction: O43918; IntAct: EBI-1958261; Score: 0.40
DE  Interaction: Q96AC6; IntAct: EBI-1958273; Score: 0.40
DE  Interaction: Q9HCQ7; IntAct: EBI-1958285; Score: 0.40
DE  Interaction: O15056; IntAct: EBI-1958297; Score: 0.40
DE  Interaction: P32239; IntAct: EBI-1958309; Score: 0.40
DE  Interaction: Q15027; IntAct: EBI-1958333; Score: 0.40
DE  Interaction: O14490; IntAct: EBI-1958369; Score: 0.40
DE  Interaction: Q8WX92; IntAct: EBI-1958345; Score: 0.40
DE  Interaction: Q9NUR3; IntAct: EBI-1958357; Score: 0.40
DE  Interaction: P13671; IntAct: EBI-1958381; Score: 0.40
DE  Interaction: P42167; IntAct: EBI-1958393; Score: 0.40
DE  Interaction: Q99572; IntAct: EBI-1958405; Score: 0.40
DE  Interaction: O15117; IntAct: EBI-1958417; Score: 0.40
DE  Interaction: Q14767; IntAct: EBI-1958429; Score: 0.40
DE  Interaction: Q9NQ76; IntAct: EBI-1958441; Score: 0.40
DE  Interaction: Q9Y2J2; IntAct: EBI-1958453; Score: 0.40
DE  Interaction: O60493; IntAct: EBI-1958465; Score: 0.40
DE  Interaction: Q9UHL9; IntAct: EBI-1958477; Score: 0.40
DE  Interaction: Q05193; IntAct: EBI-1958489; Score: 0.40
DE  Interaction: Q9ULH1; IntAct: EBI-1958501; Score: 0.40
DE  Interaction: Q9UN86; IntAct: EBI-1958513; Score: 0.40
DE  Interaction: P49916; IntAct: EBI-1958525; Score: 0.40
DE  Interaction: Q9P1A6; IntAct: EBI-1958537; Score: 0.40
DE  Interaction: Q9Y2H0; IntAct: EBI-1958551; Score: 0.40
DE  Interaction: Q9BZM3; IntAct: EBI-1958563; Score: 0.40
DE  Interaction: Q9UJT2; IntAct: EBI-1958575; Score: 0.40
DE  Interaction: P12018; IntAct: EBI-1958587; Score: 0.40
DE  Interaction: Q9ULD4; IntAct: EBI-1958599; Score: 0.40
DE  Interaction: Q9Y3Q4; IntAct: EBI-1958635; Score: 0.40
DE  Interaction: Q9NRJ4; IntAct: EBI-1958611; Score: 0.40
DE  Interaction: O60721; IntAct: EBI-1958623; Score: 0.40
DE  Interaction: O75326; IntAct: EBI-1958647; Score: 0.40
DE  Interaction: Q08209; IntAct: EBI-1958680; Score: 0.40
DE  Interaction: Q14999; IntAct: EBI-1958704; Score: 0.40
DE  Interaction: Q9BWW9; IntAct: EBI-1958716; Score: 0.40
DE  Interaction: Q8TAS1; IntAct: EBI-1958728; Score: 0.40
DE  Interaction: P21333; IntAct: EBI-1958740; Score: 0.40
DE  Interaction: P29074; IntAct: EBI-1958764; Score: 0.40
DE  Interaction: Q9UN72; IntAct: EBI-1958776; Score: 0.40
DE  Interaction: P52803; IntAct: EBI-1958788; Score: 0.40
DE  Interaction: P20774; IntAct: EBI-1958800; Score: 0.40
DE  Interaction: Q99259; IntAct: EBI-1958816; Score: 0.40
DE  Interaction: P46108; IntAct: EBI-1959666; Score: 0.67
DE  Interaction: P06241; IntAct: EBI-1961835; Score: 0.40
DE  Interaction: P62993; IntAct: EBI-1963179; Score: 0.40
DE  Interaction: P16333; IntAct: EBI-1967005; Score: 0.40
DE  Interaction: P27986; IntAct: EBI-1969653; Score: 0.40
DE  Interaction: P19174; IntAct: EBI-1970973; Score: 0.40
DE  Interaction: P18031; IntAct: EBI-8174353; Score: 0.44
DE  Interaction: Q06609; IntAct: EBI-6995587; Score: 0.40
DE  Interaction: Q15464; IntAct: EBI-7100971; Score: 0.52
DE  Interaction: O43196; IntAct: EBI-7989580; Score: 0.82
DE  Interaction: O15457; IntAct: EBI-7989665; Score: 0.37
DE  Interaction: P46109; IntAct: EBI-8046579; Score: 0.67
DE  Interaction: Q06830; IntAct: EBI-7319754; Score: 0.37
DE  Interaction: P38398; IntAct: EBI-7319796; Score: 0.37
DE  Interaction: Q9Y3L3; IntAct: EBI-7319868; Score: 0.40
DE  Interaction: P70218; IntAct: EBI-8670837; Score: 0.37
DE  Interaction: Q13444; IntAct: EBI-8061278; Score: 0.40
DE  Interaction: Q71SY5; IntAct: EBI-8595983; Score: 0.44
DE  Interaction: O35158; IntAct: EBI-7016759; Score: 0.58
DE  Interaction: Q4KMG0; IntAct: EBI-7016887; Score: 0.52
DE  Interaction: P05107; IntAct: EBI-8576224; Score: 0.52
DE  Interaction: Q9Y4G6; IntAct: EBI-8576260; Score: 0.60
DE  Interaction: P15498; IntAct: EBI-8576308; Score: 0.60
DE  Interaction: P04370; IntAct: EBI-7727798; Score: 0.40
DE  Interaction: Q7Z434; IntAct: EBI-7599276; Score: 0.59
DE  Interaction: P11387; IntAct: EBI-7328831; Score: 0.60
DE  Interaction: P35326; IntAct: EBI-7743121; Score: 0.44
DE  Interaction: Q9QUM7; IntAct: EBI-7004732; Score: 0.37
DE  Interaction: P55194; IntAct: EBI-7094170; Score: 0.44
DE  Interaction: Q64010; IntAct: EBI-2642542; Score: 0.35
DE  Interaction: P97465; IntAct: EBI-2642676; Score: 0.35
DE  Interaction: Q38SD2; IntAct: EBI-2906661; Score: 0.59
DE  Interaction: Q04929; IntAct: EBI-5278171; Score: 0.44
DE  Interaction: O95758; IntAct: EBI-7850130; Score: 0.35
DE  Interaction: P78362; IntAct: EBI-6657338; Score: 0.44
DE  Interaction: P08238; IntAct: EBI-6423900; Score: 0.40
DE  Interaction: Q99497; IntAct: EBI-8544196; Score: 0.44
DE  Interaction: P37840; IntAct: EBI-27101585; Score: 0.60
DE  Interaction: O55042; IntAct: EBI-9212687; Score: 0.27
DE  Interaction: P10275; IntAct: EBI-9451938; Score: 0.44
DE  Interaction: P10721; IntAct: EBI-9467046; Score: 0.44
DE  Interaction: P14618; IntAct: EBI-9354876; Score: 0.44
DE  Interaction: Q5S007; IntAct: EBI-9659734; Score: 0.44
DE  Interaction: Q15637; IntAct: EBI-11299755; Score: 0.00
DE  Interaction: P53999; IntAct: EBI-10101341; Score: 0.35
DE  Interaction: P26641; IntAct: EBI-10101341; Score: 0.35
DE  Interaction: Q9Y295; IntAct: EBI-10101341; Score: 0.35
DE  Interaction: Q01844; IntAct: EBI-10101341; Score: 0.35
DE  Interaction: P63220; IntAct: EBI-10101341; Score: 0.35
DE  Interaction: Q12906; IntAct: EBI-10101341; Score: 0.35
DE  Interaction: P52272; IntAct: EBI-10101341; Score: 0.35
DE  Interaction: P35637; IntAct: EBI-10101341; Score: 0.35
DE  Interaction: Q9BY44; IntAct: EBI-10101341; Score: 0.35
DE  Interaction: P27348; IntAct: EBI-10101341; Score: 0.35
DE  Interaction: P05386; IntAct: EBI-10101341; Score: 0.35
DE  Interaction: P61604; IntAct: EBI-10101341; Score: 0.35
DE  Interaction: P17844; IntAct: EBI-10101379; Score: 0.35
DE  Interaction: P12956; IntAct: EBI-10101379; Score: 0.35
DE  Interaction: Q96AG4; IntAct: EBI-10101379; Score: 0.35
DE  Interaction: Q07065; IntAct: EBI-10101379; Score: 0.35
DE  Interaction: Q6VGS8; IntAct: EBI-11733617; Score: 0.35
DE  Interaction: Q8BTZ4; IntAct: EBI-11003821; Score: 0.35
DE  Interaction: Q8BL66; IntAct: EBI-11027295; Score: 0.35
DE  Interaction: Q1H9T6; IntAct: EBI-11104278; Score: 0.35
DE  Interaction: Q15323; IntAct: EBI-24307132; Score: 0.56
DE  Interaction: P48165; IntAct: EBI-24796696; Score: 0.56
DE  Interaction: Q03135; IntAct: EBI-15875070; Score: 0.44
DE  Interaction: P42229; IntAct: EBI-15965981; Score: 0.44
DE  Interaction: P53355; IntAct: EBI-20588441; Score: 0.44
DE  Interaction: P36888; IntAct: EBI-20639282; Score: 0.44
DE  Interaction: Q03468; IntAct: EBI-21017040; Score: 0.66
DE  Interaction: O14672; IntAct: EBI-21223666; Score: 0.54
DE  Interaction: Q9BY11; IntAct: EBI-21376479; Score: 0.00
DE  Interaction: P51692; IntAct: EBI-25432371; Score: 0.56
DE  Interaction: P60006; IntAct: EBI-27039580; Score: 0.37
DE  Interaction: O14641; IntAct: EBI-27039584; Score: 0.37
DE  Interaction: Q9H4M7; IntAct: EBI-27039588; Score: 0.37
DE  Interaction: Q8IYX8; IntAct: EBI-27039592; Score: 0.37
DE  Interaction: Q8TAP6; IntAct: EBI-27039596; Score: 0.37
DE  Interaction: O14595; IntAct: EBI-27039600; Score: 0.37
DE  Interaction: O94818; IntAct: EBI-27039604; Score: 0.37
DE  Interaction: P46531; IntAct: EBI-27039608; Score: 0.37
DE  Interaction: P56279; IntAct: EBI-27039612; Score: 0.37
DE  Interaction: Q96GJ1; IntAct: EBI-27039616; Score: 0.37
DE  Interaction: P42684; IntAct: EBI-27039620; Score: 0.37
DE  Interaction: Q13619; IntAct: EBI-30863570; Score: 0.35
DE  Interaction: Q13620; IntAct: EBI-30863806; Score: 0.35
DE  Interaction: Q06418; IntAct: EBI-32719716; Score: 0.35
GO  GO:0015629;
GO  GO:0005737;
GO  GO:0005829;
GO  GO:0030425;
GO  GO:0005783;
GO  GO:0030426;
GO  GO:0005739;
GO  GO:0043025;
GO  GO:0016604;
GO  GO:0031965;
GO  GO:0005730;
GO  GO:0005654;
GO  GO:0005634;
GO  GO:0048471;
GO  GO:0098794;
GO  GO:0032991;
GO  GO:0001726;
GO  GO:0051015;
GO  GO:0003785;
GO  GO:0005524;
GO  GO:0000405;
GO  GO:0070097;
GO  GO:0003677;
GO  GO:0046875;
GO  GO:0000400;
GO  GO:0016301;
GO  GO:0000287;
GO  GO:0030145;
GO  GO:0051019;
GO  GO:0038191;
GO  GO:0004515;
GO  GO:0004715;
GO  GO:0001784;
GO  GO:0070064;
GO  GO:0008022;
GO  GO:0004672;
GO  GO:0005080;
GO  GO:0043621;
GO  GO:0004713;
GO  GO:1990837;
GO  GO:0042169;
GO  GO:0017124;
GO  GO:0019905;
GO  GO:0003713;
GO  GO:0030036;
GO  GO:0030041;
GO  GO:0050798;
GO  GO:1990051;
GO  GO:0046632;
GO  GO:0008306;
GO  GO:0006914;
GO  GO:0002322;
GO  GO:0050853;
GO  GO:0001922;
GO  GO:0060020;
GO  GO:0030509;
GO  GO:0060038;
GO  GO:0098609;
GO  GO:0006974;
GO  GO:1903351;
GO  GO:0070301;
GO  GO:0071222;
GO  GO:0034599;
GO  GO:0071560;
GO  GO:0090398;
GO  GO:0021587;
GO  GO:1904157;
GO  GO:0071103;
GO  GO:0006975;
GO  GO:0006897;
GO  GO:0043542;
GO  GO:0007173;
GO  GO:0070371;
GO  GO:0051649;
GO  GO:0038096;
GO  GO:0007249;
GO  GO:0007229;
GO  GO:0008630;
GO  GO:0030035;
GO  GO:0006298;
GO  GO:0051882;
GO  GO:0000278;
GO  GO:0051450;
GO  GO:0030514;
GO  GO:0022408;
GO  GO:2000773;
GO  GO:2000352;
GO  GO:0070373;
GO  GO:0043124;
GO  GO:1900272;
GO  GO:0045930;
GO  GO:1900275;
GO  GO:0071901;
GO  GO:0051444;
GO  GO:0001843;
GO  GO:0060563;
GO  GO:0050885;
GO  GO:0070997;
GO  GO:0030182;
GO  GO:0038189;
GO  GO:0038083;
GO  GO:0018108;
GO  GO:0035791;
GO  GO:1903210;
GO  GO:2000251;
GO  GO:1904531;
GO  GO:0043065;
GO  GO:1905555;
GO  GO:0090050;
GO  GO:0007204;
GO  GO:1900006;
GO  GO:0010595;
GO  GO:0070374;
GO  GO:1903905;
GO  GO:1903055;
GO  GO:0048146;
GO  GO:0051894;
GO  GO:1901300;
GO  GO:0043123;
GO  GO:0032729;
GO  GO:0032743;
GO  GO:1904528;
GO  GO:0045931;
GO  GO:0043525;
GO  GO:0033690;
GO  GO:0051353;
GO  GO:0050731;
GO  GO:0001934;
GO  GO:0051281;
GO  GO:0051496;
GO  GO:1900026;
GO  GO:2000406;
GO  GO:0045944;
GO  GO:0045907;
GO  GO:2000096;
GO  GO:0009791;
GO  GO:0046777;
GO  GO:1904518;
GO  GO:0036211;
GO  GO:0006468;
GO  GO:0032956;
GO  GO:2000249;
GO  GO:0042981;
GO  GO:0010506;
GO  GO:0030516;
GO  GO:0032489;
GO  GO:0030155;
GO  GO:0051726;
GO  GO:2000145;
GO  GO:0006355;
GO  GO:0030100;
GO  GO:1902036;
GO  GO:0031113;
GO  GO:1905244;
GO  GO:2001020;
GO  GO:0045580;
GO  GO:0034976;
GO  GO:0071871;
GO  GO:0006979;
GO  GO:0009410;
GO  GO:0042770;
GO  GO:0048536;
GO  GO:0034446;
GO  GO:0050852;
GO  GO:0048538;
GO  GO:0002333;
TP  Membrane Topology: Lipid-Anchored; Source: UniProt - Sequence Analysis;
SQ  MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTL
SQ  SITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQ
SQ  RSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERT
SQ  DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTY
SQ  GNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAK
SQ  FPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SQ  SDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESD
SQ  PLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRD
SQ  ISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSAS
SQ  CVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKD
SQ  IMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKH
SQ  SSESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVL
SQ  PATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALC
SQ  LAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSS
SQ  VKEISDIVQR
//