ID  P03086;
PN  Agnoprotein;
GN  AGNO;
OS  10632;
SL  Nucleus Position: SL-0415;
SL  Nucleus Position: SL-0418;
SL  Comments: Host cytoplasm {ECO:0000305}. Host nucleus membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}. Host rough endoplasmic reticulum membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}. Host cell membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}. Note=Mostly perinuclear. {ECO:0000269|PubMed:11517407, ECO:0000269|PubMed:15864296, ECO:0000269|PubMed:20300659}.
DR  UNIPROT: P03086;
DR  PDB: 2MJ2;
DR  PDB: 5NHQ;
DR  Pfam: PF01736;
DE  Function: Alters the structure of the nuclear envelope by interacting with host CBX5 and disrupting CBX5 association with LBR. Involved in the perinuclear-nuclear localization of the capsid protein VP1 during virion assembly and maturation. Plays an important role in the release of progeny virions from infected cells and in viral propagation, probably by acting as a viral ionic channel in the host plasma membrane. Allows influx of extracellular calcium ions in the host cell. May contribute to viral genome transcription and translation of viral late proteins. {ECO:0000269|PubMed:11517407, ECO:0000269|PubMed:12165856, ECO:0000269|PubMed:20300659}.
DE  Reference Proteome: Yes;
GO  GO:0044200;
GO  GO:0020002;
GO  GO:0044169;
GO  GO:0016021;
GO  GO:0044385;
GO  GO:0003677;
GO  GO:0005216;
GO  GO:0039707;
GO  GO:0051259;
TP  Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255};
SQ  MVLRQLSRKASVKVSKTWSGTKKRAQRILIFLLEFLLDFCTGEDSVDGKKRQRHSGLTEQTYSALPEPKAT
//