ID  P03519;
PN  Matrix protein;
GN  M;
OS  11285;
SL  Nucleus Position: SL-0415;
SL  Nucleus Position: SL-0418;
SL  Comments: Virion membrane; Peripheral membrane protein {ECO:0000269|PubMed:1850035}. Host endomembrane system; Peripheral membrane protein. Host nucleus membrane; Peripheral membrane protein. Host nucleus {ECO:0000269|PubMed:28888655}. Host cytoplasm {ECO:0000269|PubMed:28888655}.
DR  UNIPROT: P03519;
DR  Pfam: PF06326;
DE  Function: Plays a major role in assembly and budding of virion, by recruiting cellular partners of the ESCRT complexes that play a key role in releasing the budding particle from the host membrane. Condensates the ribonucleocapsid core during virus assembly. {ECO:0000269|PubMed:16298982, ECO:0000269|PubMed:20943988}. Inhibits mRNA nuclear export through direct interaction with host RAE1-NUP98 complex, thereby preventing interferon signaling and establishment of antiviral state in infected cells (PubMed:15629720, PubMed:33849972). Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell (PubMed:15629720). Inhibits host transcription, possibly through interaction with host DNA repair factor IIH/TFIIH GTF2H5 subunit (PubMed:28888655). {ECO:0000269|PubMed:15629720, ECO:0000269|PubMed:28888655, ECO:0000269|PubMed:33849972}.
DE  Reference Proteome: Yes;
DE  Interaction: Q9BUJ2; IntAct: EBI-7228130; Score: 0.40
DE  Interaction: P78406; IntAct: EBI-7228174; Score: 0.53
DE  Interaction: P52948; IntAct: EBI-7228174; Score: 0.53
GO  GO:0030430;
GO  GO:0044200;
GO  GO:0016020;
GO  GO:0019031;
GO  GO:0055036;
GO  GO:0039660;
GO  GO:0016310;
GO  GO:0039522;
GO  GO:0039602;
GO  GO:0039702;
TP  Membrane Topology: Peripheral; Source: UniProt - Experimental Evidence {ECO:0000269|PubMed:1850035};
SQ  MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTYDPNQLRYEKFFFTVKMTVRSNRPFRT
SQ  YSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHTHCEGRAYLPHRMGKTPPMLNVPEHFRR
SQ  PFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKASGAWVLDSISHFK
//