ID P04492; PN E1B protein, small T-antigen; GN E1BS; OS 28282; SL Nucleus Position: SL-0415; SL Nucleus Position: SL-0416; SL Comments: Host cell membrane {ECO:0000250}. Host nucleus envelope {ECO:0000250}. Host nucleus lamina {ECO:0000250}. Note=Associated with the plasma and nuclear membranes, and with the insoluble nuclear lamina. {ECO:0000250}. DR UNIPROT: P04492; DR Pfam: PF01691; DR PROSITE: PS50062; DE Function: Putative adenovirus Bcl-2 homolog that inhibits apoptosis induced by TNF or FAS pathways, as well as p53-mediated apoptosis. Without E1B 19K function, virus production is compromised because of premature death of host cell. Interacts with Bax protein in cell lysates (By similarity). {ECO:0000250}. DE Reference Proteome: No; GO GO:0044203; GO GO:0020002; GO GO:0016020; GO GO:0019050; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MELETVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVNRVKEDYREEFENILADCPGLLASLDLCYHLVFQEKVVRS SQ LDFSSVGRTVASIAFLATILDKWSEKSHLSWDYMLDYMSMQLWRAWLKRRVCIYSLARPLTMPPLPTLQEEKEEERNPAV SQ VEK //