ID  P08325;
PN  Matrix protein;
GN  M;
OS  11283;
SL  Nucleus Position: SL-0415;
SL  Nucleus Position: SL-0418;
SL  Comments: Virion membrane; Peripheral membrane protein. Host endomembrane system; Peripheral membrane protein. Host nucleus membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}.
DR  UNIPROT: P08325;
DR  PDB: 2W2R;
DR  Pfam: PF06326;
DE  Function: Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shutoff presumably inhibits interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell (By similarity). {ECO:0000250}.
DE  Reference Proteome: No;
DE  Interaction: Q12906; IntAct: EBI-15693264; Score: 0.50
DE  Interaction: P07910; IntAct: EBI-15693290; Score: 0.35
GO  GO:0044200;
GO  GO:0016020;
GO  GO:0019031;
GO  GO:0055036;
GO  GO:0039660;
GO  GO:0039657;
GO  GO:0039522;
GO  GO:0039702;
TP  Membrane Topology: Peripheral; Source: UniProt - By Similarity {ECO:0000250};
SQ  MSSFKKILGLSSKSHKKSKKMGLPPPYDESCPMETQPSAPLSNDFFGMEDMDLYDKDSLRYEKFRFMLKMTVRSNKPFRS
SQ  YDDVTAAVSQWDNSYIGMVGKRPFYKIIAVIGSSHLQATPAVLADLNQPEYYATLTGRCFLPHRLGLIPPMFNVQETFRK
SQ  PFNIGLYKGTLDFTFTVSDDESNEKVPHVWDYMNPKYQSQIQQEGLKFGLILSKKATGTWVLDQLSPFK
//