ID  P08928;
PN  Lamin Dm0;
GN  Lam;
OS  7227;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0179;
SL  Nucleus Position: SL-0180;
SL  Nucleus Position: SL-0182;
SL  Comments: Nucleus {ECO:0000269|PubMed:7593280, ECO:0000269|PubMed:9199347}. Nucleus inner membrane {ECO:0000269|PubMed:16439308}. Nucleus envelope {ECO:0000269|PubMed:15035436, ECO:0000269|PubMed:16439308, ECO:0000269|PubMed:8999964, ECO:0000269|PubMed:9199347, ECO:0000269|PubMed:9632815}. Nucleus lamina {ECO:0000269|PubMed:18723885}. Cytoplasm, cytoskeleton, spindle pole {ECO:0000269|PubMed:16439308, ECO:0000269|PubMed:27402967}. Cytoplasm {ECO:0000269|PubMed:9199347}. Note=Nuclear periphery (PubMed:7593280). At metaphase and anaphase, weakly expressed in the nuclear envelope and spindle poles (PubMed:16439308). Expression in oocyte cytoplasm increases after stages 6 to 7 of egg development (PubMed:9199347). In spermatocytes detected at the spindle envelope, spindle poles and astral membrane throughout meiosis I, whereas mostly depleted in meiosis II (PubMed:27402967). Colocalizes with nuclear pore complex component Nup107 throughout meiosis I (PubMed:27402967). {ECO:0000269|PubMed:16439308, ECO:0000269|PubMed:27402967, ECO:0000269|PubMed:7593280, ECO:0000269|PubMed:9199347}.
DR  UNIPROT: P08928;
DR  UNIPROT: Q9VMQ0;
DR  Pfam: PF00038;
DR  Pfam: PF00932;
DR  PROSITE: PS51842;
DR  PROSITE: PS51841;
DE  Function: Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin (PubMed:3126192, PubMed:15035436). May have a role in the localization of the LEM domain proteins Ote, bocks and MAN1 to the nuclear membrane (PubMed:15035436, PubMed:16439308). In spermatocytes, plays a role in maintaining type-A lamin LamC nuclear localization; regulates meiotic cytokinesis by maintaining the structure of the spindle envelope, and by contributing to the formation of the contractile ring and central spindle (PubMed:27402967). Required for nuclear migration and to link the microtubule organizing center (MTOC) to the nucleus (PubMed:14617811). In addition, is required for nuclear envelope localization of klar (PubMed:14617811). {ECO:0000269|PubMed:14617811, ECO:0000269|PubMed:15035436, ECO:0000269|PubMed:16439308, ECO:0000269|PubMed:27402967, ECO:0000269|PubMed:3126192}.
DE  Reference Proteome: Yes;
DE  Interaction: Q9VR64; IntAct: EBI-251111; Score: 0.00
DE  Interaction: P52295; IntAct: EBI-275111; Score: 0.00
DE  Interaction: P20240; IntAct: EBI-873490; Score: 0.50
DE  Interaction: Q9VD23; IntAct: EBI-281902; Score: 0.00
DE  Interaction: Q8T3J9; IntAct: EBI-281906; Score: 0.00
DE  Interaction: Q9VAU6; IntAct: EBI-281910; Score: 0.00
DE  Interaction: Q9XTM1; IntAct: EBI-510092; Score: 0.00
DE  Interaction: P16568; IntAct: EBI-871614; Score: 0.27
DE  Interaction: P25028; IntAct: EBI-872894; Score: 0.27
DE  Interaction: O01382; IntAct: EBI-873330; Score: 0.27
DE  Interaction: P08928; IntAct: EBI-873494; Score: 0.27
DE  Interaction: P34082; IntAct: EBI-9928090; Score: 0.53
DE  Interaction: P92177; IntAct: EBI-8283416; Score: 0.35
DE  Interaction: Q24247; IntAct: EBI-9936906; Score: 0.35
DE  Interaction: Q9V9S0; IntAct: EBI-9937938; Score: 0.35
DE  Interaction: Q9VMV9; IntAct: EBI-9939888; Score: 0.35
DE  Interaction: Q9VPX2; IntAct: EBI-9940633; Score: 0.46
DE  Interaction: Q9VMT1; IntAct: EBI-9940945; Score: 0.35
DE  Interaction: P23226; IntAct: EBI-9942879; Score: 0.35
DE  Interaction: Q8IQX8; IntAct: EBI-9943015; Score: 0.35
DE  Interaction: Q9VT04; IntAct: EBI-9943330; Score: 0.35
DE  Interaction: Q8SXF0; IntAct: EBI-9943546; Score: 0.35
DE  Interaction: A0A0B4KGY6; IntAct: EBI-9952257; Score: 0.35
DE  Interaction: M9NFI9; IntAct: EBI-9959939; Score: 0.35
DE  Interaction: Q8IPM8; IntAct: EBI-9961408; Score: 0.35
GO  GO:0005737;
GO  GO:0005638;
GO  GO:0005635;
GO  GO:0005641;
GO  GO:0005637;
GO  GO:0005652;
GO  GO:0005634;
GO  GO:0000922;
GO  GO:0003682;
GO  GO:0005102;
GO  GO:0005200;
GO  GO:0007417;
GO  GO:0040003;
GO  GO:0001745;
GO  GO:0048546;
GO  GO:0035262;
GO  GO:0031507;
GO  GO:0070828;
GO  GO:0007112;
GO  GO:0007110;
GO  GO:0007084;
GO  GO:0008285;
GO  GO:0050777;
GO  GO:0006998;
GO  GO:0071763;
GO  GO:0007097;
GO  GO:0051664;
GO  GO:0006997;
GO  GO:0030838;
GO  GO:2000433;
GO  GO:1900182;
GO  GO:1905832;
GO  GO:0090435;
GO  GO:0048137;
GO  GO:0007283;
GO  GO:0007430;
TP  Membrane Topology: Lipid-Anchored; Source: UniProt - By Similarity {ECO:0000250};
SQ  MSSKSRRAGTATPQPGNTSTPRPPSAGPQPPPPSTHSQTASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENS
SQ  RLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMY
SQ  ESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINE
SQ  SRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRV
SQ  RIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYD
SQ  KLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDP
SQ  EGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQKWVSADNTR
SQ  TILLNSEGEAVANLDRIKRIVSQHTSSSRLSRRRSVTAVDGNEQLYHQQGDPQQSNEKCAIM
//