ID  P13285;
PN  Latent membrane protein 2;
GN  LMP2;
OS  10377;
SL  Nucleus Position: SL-0382;
SL  Comments: [Isoform LMP2A]: Host cell membrane {ECO:0000269|PubMed:11163230, ECO:0000269|PubMed:11961256}; Multi-pass membrane protein {ECO:0000269|PubMed:11163230, ECO:0000269|PubMed:11961256}. Note=Isoform LMP2A is localized in plasma membrane lipid rafts. {ECO:0000269|PubMed:11163230}. [Isoform LMP2B]: Host endomembrane system {ECO:0000269|PubMed:11961256}; Multi-pass membrane protein {ECO:0000269|PubMed:11961256}. Host cytoplasm, host perinuclear region {ECO:0000269|PubMed:11961256}. Note=Isoform LMP2B localizes to perinuclear regions. {ECO:0000269|PubMed:11961256}.
DR  UNIPROT: P13285;
DR  UNIPROT: Q777H4;
DR  UNIPROT: Q8AZK9;
DR  PDB: 1UXS;
DR  PDB: 1UXW;
DR  PDB: 2JO9;
DR  PDB: 3BVN;
DR  PDB: 3REW;
DR  PDB: 5GRD;
DR  PDB: 5GSD;
DR  Pfam: PF07415;
DE  Function: Isoform LMP2A maintains EBV latent infection of B-lymphocyte, by preventing lytic reactivation of the virus in response to surface immunoglobulin (sIg) cross-linking. Acts like a dominant negative inhibitor of the sIg-associated protein tyrosine kinases, LYN and SYK. Also blocks translocation of the B-cell antigen receptor (BCR) into lipid rafts, preventing the subsequent signaling and accelerated internalization of the BCR upon BCR cross-linking. Serves as a molecular scaffold to recruit SYK, LYN and E3 protein-ubiquitin ligases, such as ITCH and NEDD4L, leading to ubiquitination and potential degradation of both tyrosines kinases. Possesses a constitutive signaling activity in non-transformed cells, inducing bypass of normal B lymphocyte developmental checkpoints allowing immunoglobulin-negative cells to colonize peripheral lymphoid organs. Isoform LMP2B may be a negative regulator of isoform LMP2A.
DE  Reference Proteome: Yes;
DE  Interaction: P0CK48; IntAct: EBI-9645790; Score: 0.37
DE  Interaction: Q96J02; IntAct: EBI-7181105; Score: 0.59
DE  Interaction: P08107; IntAct: EBI-8661700; Score: 0.35
DE  Interaction: P25939; IntAct: EBI-9645775; Score: 0.37
DE  Interaction: G3E2M5; IntAct: EBI-9645780; Score: 0.37
DE  Interaction: P03219; IntAct: EBI-9645785; Score: 0.37
DE  Interaction: M1FZY5; IntAct: EBI-9645805; Score: 0.37
DE  Interaction: Q1HVD3; IntAct: EBI-9645800; Score: 0.37
DE  Interaction: P03199; IntAct: EBI-9645795; Score: 0.37
DE  Interaction: Q3KSQ7; IntAct: EBI-9645814; Score: 0.37
DE  Interaction: Q9NZM1; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: O60494; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: O00308; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q9H0M0; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q9BQB6; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q16739; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q8TF42; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q8NBM4; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q5JTV8; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q9H0E2; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P37173; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: O15260; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q9UQ35; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: O15269; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: O60493; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q9P0P0; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: O95456; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q14997; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P61289; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q9UL46; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q06323; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P48556; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P51665; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q15008; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P55036; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: O43242; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: O00487; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q99460; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P62333; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P62195; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P43686; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P17980; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P35998; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P62191; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P28065; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P28062; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q99436; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P28072; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P28074; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P28070; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P49720; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P49721; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P20618; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: O14818; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P60900; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P28066; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P25789; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P25788; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P25787; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P25786; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: O60831; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: O15031; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q99623; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P09619; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q96PU5; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P46934; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q96N66; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q7Z4F1; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q15012; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P11279; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q8TED1; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q14517; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q9GZU8; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q96CS3; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P50402; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q9H5V8; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P16070; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q8NC54; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P30530; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P98194; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: P16615; IntAct: EBI-11733017; Score: 0.35
DE  Interaction: Q8IZ07; IntAct: EBI-11733017; Score: 0.35
GO  GO:0033645;
GO  GO:0044220;
GO  GO:0020002;
GO  GO:0016021;
GO  GO:0039648;
GO  GO:0039649;
GO  GO:0019042;
TP  Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255};
SQ  MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQ
SQ  DQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTASVSTVVTATGLALS
SQ  LLLLAAVASSYAAAQRKLLTPVTVLTAVVTFFAICLTWRIEDPPFNSLLFALLAAAGGLQGIYVLVMLVLLILAYRRRWR
SQ  RLTVCGGIMFLACVLVLIVDAVLQLSPLLGAVTVVSMTLLLLAFVLWLSSPGGLGTLGAALLTLAAALALLASLILGTLN
SQ  LTTMFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASALIAGGSILQTNFKSLSSTEFIPNLFCMLLLIV
SQ  AGILFILAILTEWGSGNRTYGPVFMCLGGLLTMVAGAVWLTVMSNTLLSAWILTAGFLIFLIGFALFGVIRCCRYCCYYC
SQ  LTLESEERPPTPYRNTV
//