ID P14069; PN Protein S100-A6; GN S100a6; OS 10090; SL Nucleus Position: SL-0178; SL Comments: Nucleus envelope {ECO:0000250}. Cytoplasm {ECO:0000250}. Cell membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}; Cytoplasmic side {ECO:0000250}. DR UNIPROT: P14069; DR PDB: 4P2Y; DR Pfam: PF01023; DR PROSITE: PS00018; DR PROSITE: PS50222; DR PROSITE: PS00303; DE Function: May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; DE Interaction: P30416; IntAct: EBI-7835551; Score: 0.35 DE Interaction: Q08752; IntAct: EBI-7835551; Score: 0.35 DE Interaction: Q9CXW3; IntAct: EBI-6478783; Score: 0.65 DE Interaction: A0A0F6B423; IntAct: EBI-13953902; Score: 0.35 GO GO:0062023; GO GO:0005737; GO GO:0005829; GO GO:0031234; GO GO:0005635; GO GO:0005634; GO GO:0048471; GO GO:0005886; GO GO:0001726; GO GO:0005509; GO GO:0048306; GO GO:0015075; GO GO:0042803; GO GO:0044548; GO GO:0005523; GO GO:0008270; TP Membrane Topology: Peripheral; Source: UniProt - By Similarity {ECO:0000250}; SQ MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGAL SQ ALIYNEALK //