ID P16794; PN Nuclear egress protein 1; GN NEC1; OS 10360; SL Nucleus Position: SL-0415; SL Nucleus Position: SL-0418; SL Nucleus Position: SL-0419; SL Comments: Host nucleus inner membrane {ECO:0000255|HAMAP- Rule:MF_04023, ECO:0000269|PubMed:11961254, ECO:0000269|PubMed:25339763, ECO:0000269|PubMed:26511021, ECO:0000269|PubMed:31980459}. Note=Remains attached to the nucleus inner membrane through interaction with NEC2. {ECO:0000255|HAMAP- Rule:MF_04023, ECO:0000269|PubMed:26511021}. DR UNIPROT: P16794; DR UNIPROT: Q7M6N0; DR PDB: 5DOB; DR PDB: 5DOC; DR PDB: 5DOE; DR PDB: 6T3X; DR Pfam: PF02718; DE Function: Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network. {ECO:0000255|HAMAP-Rule:MF_04023, ECO:0000269|PubMed:25339763}. DE Reference Proteome: Yes; GO GO:0044201; GO GO:0016020; GO GO:0046872; GO GO:0046765; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MSSVSGVRTPRERRSALRSLLRKRRQRELASKVASTVNGATSANNHGEPPSPADARPRLTLHDLHDIFREHPELELKYLN SQ MMKMAITGKESICLPFNFHSHRQHTCLDISPYGNEQVSRIACTSCEDNRILPTASDAMVAFINQTSNIMKNRNFYYGFCK SQ SSELLKLSTNQPPIFQIYYLLHAANHDIVPFMHAEDGRLHMHVIFENPDVHIPCDCITQMLTAAREDYSVTLNIVRDHVV SQ ISVLCHAVSASSVKIDVTILQRKIDEMDIPNDVSESFERYKELIQELCQSSGNNLYEEATSSYAIRSPLTASPLHVVSTN SQ GCGPSSSSQSTPPHLHPPSQATQPHHYSHHQSQSQQHHHRPQSPPPPLFLNSIRAP //