ID  P19325;
PN  RING finger protein Z;
GN  Z;
OS  11626;
SL  Nucleus Position: SL-0382;
SL  Comments: Virion. Host cytoplasm, host perinuclear region. Host cell membrane; Lipid-anchor; Cytoplasmic side. Note=Mainly perinuclear. During budding, associates at the inner side of the plasma membrane of infected cells (By similarity). {ECO:0000250}.
DR  UNIPROT: P19325;
DR  Pfam: PF03854;
DE  Function: Plays a crucial role in virion assembly and budding. Expressed late in the virus life cycle, it acts as an inhibitor of viral transcription and RNA synthesis by interacting with the viral polymerase L. Presumably recruits the NP encapsidated genome to cellular membranes at budding sites via direct interaction with NP. The budding of the virus progeny occurs after association of protein Z with the viral glycoprotein complex SSP-GP1-GP2 at the cell periphery, step that requires myristoylation of protein Z (By similarity). {ECO:0000250}.
DE  Reference Proteome: No;
GO  GO:0044220;
GO  GO:0020002;
GO  GO:0016020;
GO  GO:0044423;
GO  GO:0003723;
GO  GO:0008270;
TP  Membrane Topology: Lipid-Anchored; Source: UniProt - By Similarity {ECO:0000250};
SQ  MGQSKSKEEKGISGTSRAEILPDTTYLGPLNCKSCWQKFDSFSKCHDHYLCRHCLNLLLTSSDRCPLCKYPL
//