ID  P19475;
PN  Nucleoprotein;
GN  N;
OS  1337063;
SL  Nucleus Position: SL-0382;
SL  Comments: Virion {ECO:0000250|UniProtKB:P05133}. Host cytoplasm, host perinuclear region {ECO:0000250|UniProtKB:P05133}. Host Golgi apparatus, host cis-Golgi network {ECO:0000250|UniProtKB:P05133}. Note=Internal protein of virus particle. {ECO:0000250|UniProtKB:P05133}.
DR  UNIPROT: P19475;
DR  Pfam: PF00846;
DE  Function: Encapsidates the genome protecting it from nucleases (Probable). The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication (Probable). The nucleocapsid has a left-handed helical structure (By similarity). As a trimer, specifically binds and acts as a chaperone to unwind the panhandle structure formed by the viral RNA (vRNA) termini (By similarity). Involved in the transcription and replication initiation of vRNA by mediating primer annealing (By similarity). Plays a role in cap snatching by sequestering capped RNAs in P bodies for use by the viral RdRp during transcription initiation (By similarity). Substitutes for the cellular cap-binding complex (eIF4F) to preferentially facilitate the translation of capped mRNAs (By similarity). Initiates the translation by specifically binding to the cap and 40S ribosomal subunit (By similarity). Prevents the viral glycoprotein N (Gn) from autophagy-dependent breakdown maybe by blocking autophagosome formation (By similarity). Inhibits host EIF2AK2/PKR dimerization to prevent PKR-induced translational shutdown in cells and thus the activation of the antiviral state (By similarity). Also displays sequence-unspecific DNA endonuclease activity (By similarity). {ECO:0000250|UniProtKB:O36307, ECO:0000250|UniProtKB:P05133, ECO:0000250|UniProtKB:Q89462, ECO:0000305}.
DE  Reference Proteome: No;
GO  GO:0019029;
GO  GO:0044177;
GO  GO:0044220;
GO  GO:1990904;
GO  GO:0019013;
GO  GO:0004519;
GO  GO:0003723;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MSDLTDIQEEITRHEQQLVVARQKLKDAERAVEVDPDDVNKSTLQARQQTVSALEDKLADYKRRMADAVSRKKMDTKPTD
SQ  PTGIEPDDHLKERSSLRYGNVLDVNAIDIEEPSGQTADWYTIGVYVIGFTIPIILKALYMLSTRGRQTVKENKGTRIRFK
SQ  DDTSFEDINGIRRPKHLYVSMPTAQSTMKAEELTPGRFRTIVCGLFPTQIQVRNIMSPVMGVIGFSFFVKDWPEKIREFM
SQ  EKECPFIKPEVKPGTPAQEVEFLKRNRVYFMTRQDVLDKNHVADIDKLIDYAASGDPTSPDDIESPNAPWVFACAPDRCP
SQ  PTCIYVAGMAELGAFFSILQDMRNTIMASKTVGTAEEKLKKKSSFYQSYLRRTQSMGIQLDQRIILLYMLEWGREMVDHF
SQ  HLGDDMDPELRGLAQSLIDQKVKEISNQEPLKI
//