ID  P19525;
PN  Interferon-induced, double-stranded RNA-activated protein kinase;
GN  EIF2AK2;
OS  9606;
SL  Nucleus Position: SL-0198;
SL  Comments: Cytoplasm {ECO:0000269|PubMed:15121867, ECO:0000269|PubMed:21029237, ECO:0000269|PubMed:22214662}. Nucleus {ECO:0000269|PubMed:21029237, ECO:0000269|PubMed:21072047}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:15121867}. Note=Nuclear localization is elevated in acute leukemia, myelodysplastic syndrome (MDS), melanoma, breast, colon, prostate and lung cancer patient samples or cell lines as well as neurocytes from advanced Creutzfeldt- Jakob disease patients. {ECO:0000269|PubMed:21072047}.
DR  UNIPROT: P19525;
DR  UNIPROT: A8K3P0;
DR  UNIPROT: D6W584;
DR  UNIPROT: E9PC80;
DR  UNIPROT: Q52M43;
DR  UNIPROT: Q7Z6F6;
DR  UNIPROT: Q9UIR4;
DR  PDB: 1QU6;
DR  PDB: 2A19;
DR  PDB: 2A1A;
DR  PDB: 3UIU;
DR  PDB: 6D3K;
DR  PDB: 6D3L;
DR  Pfam: PF00035;
DR  Pfam: PF00069;
DR  PROSITE: PS50137;
DR  PROSITE: PS00107;
DR  PROSITE: PS50011;
DR  PROSITE: PS00108;
DR  OMIM: 176871;
DR  OMIM: 618877;
DR  OMIM: 619687;
DR  DisGeNET: 5610;
DE  Function: IFN-induced dsRNA-dependent serine/threonine-protein kinase that phosphorylates the alpha subunit of eukaryotic translation initiation factor 2 (EIF2S1/eIF-2-alpha) and plays a key role in the innate immune response to viral infection (PubMed:18835251, PubMed:19507191, PubMed:19189853, PubMed:21123651, PubMed:21072047, PubMed:22948139, PubMed:23229543, PubMed:22381929). Inhibits viral replication via the integrated stress response (ISR): EIF2S1/eIF-2- alpha phosphorylation in response to viral infection converts EIF2S1/eIF-2-alpha in a global protein synthesis inhibitor, resulting to a shutdown of cellular and viral protein synthesis, while concomitantly initiating the preferential translation of ISR-specific mRNAs, such as the transcriptional activator ATF4 (PubMed:19189853, PubMed:21123651, PubMed:22948139, PubMed:23229543). Exerts its antiviral activity on a wide range of DNA and RNA viruses including hepatitis C virus (HCV), hepatitis B virus (HBV), measles virus (MV) and herpes simplex virus 1 (HHV-1) (PubMed:11836380, PubMed:19189853, PubMed:20171114, PubMed:19840259, PubMed:21710204, PubMed:23115276, PubMed:23399035). Also involved in the regulation of signal transduction, apoptosis, cell proliferation and differentiation: phosphorylates other substrates including p53/TP53, PPP2R5A, DHX9, ILF3, IRS1 and the HHV-1 viral protein US11 (PubMed:11836380, PubMed:22214662, PubMed:19229320). In addition to serine/threonine- protein kinase activity, also has tyrosine-protein kinase activity and phosphorylates CDK1 at 'Tyr-4' upon DNA damage, facilitating its ubiquitination and proteosomal degradation (PubMed:20395957). Either as an adapter protein and/or via its kinase activity, can regulate various signaling pathways (p38 MAP kinase, NF-kappa-B and insulin signaling pathways) and transcription factors (JUN, STAT1, STAT3, IRF1, ATF3) involved in the expression of genes encoding pro-inflammatory cytokines and IFNs (PubMed:22948139, PubMed:23084476, PubMed:23372823). Activates the NF-kappa-B pathway via interaction with IKBKB and TRAF family of proteins and activates the p38 MAP kinase pathway via interaction with MAP2K6 (PubMed:10848580, PubMed:15121867, PubMed:15229216). Can act as both a positive and negative regulator of the insulin signaling pathway (ISP) (PubMed:20685959). Negatively regulates ISP by inducing the inhibitory phosphorylation of insulin receptor substrate 1 (IRS1) at 'Ser-312' and positively regulates ISP via phosphorylation of PPP2R5A which activates FOXO1, which in turn up-regulates the expression of insulin receptor substrate 2 (IRS2) (PubMed:20685959). Can regulate NLRP3 inflammasome assembly and the activation of NLRP3, NLRP1, AIM2 and NLRC4 inflammasomes (PubMed:22801494). Plays a role in the regulation of the cytoskeleton by binding to gelsolin (GSN), sequestering the protein in an inactive conformation away from actin (By similarity). {ECO:0000250|UniProtKB:Q03963, ECO:0000269|PubMed:10848580, ECO:0000269|PubMed:11836380, ECO:0000269|PubMed:15121867, ECO:0000269|PubMed:15229216, ECO:0000269|PubMed:18835251, ECO:0000269|PubMed:19189853, ECO:0000269|PubMed:19229320, ECO:0000269|PubMed:19507191, ECO:0000269|PubMed:19840259, ECO:0000269|PubMed:20171114, ECO:0000269|PubMed:20395957, ECO:0000269|PubMed:20685959, ECO:0000269|PubMed:21072047, ECO:0000269|PubMed:21123651, ECO:0000269|PubMed:21710204, ECO:0000269|PubMed:22214662, ECO:0000269|PubMed:22381929, ECO:0000269|PubMed:22801494, ECO:0000269|PubMed:22948139, ECO:0000269|PubMed:23084476, ECO:0000269|PubMed:23115276, ECO:0000269|PubMed:23229543, ECO:0000269|PubMed:23372823, ECO:0000269|PubMed:23399035, ECO:0000269|PubMed:32197074}.
DE  Disease: Leukoencephalopathy, developmental delay, and episodic neurologic regression syndrome (LEUDEN) [MIM:618877]: An autosomal dominant disorder characterized by global developmental delay apparent in early childhood, cognitive impairment, ataxia, poor or absent speech with dysarthria, hypotonia, hypertonia, extrapyramidal signs, tremor, and abnormal involuntary movements. Affected individuals also exhibit neurological regression in the setting of febrile illness or infection. Many patients have seizures. Brain imaging shows diffuse white matter abnormalities with poor myelination. {ECO:0000269|PubMed:32197074}. Note=The disease may be caused by variants affecting the gene represented in this entry. Dystonia 33 (DYT33) [MIM:619687]: A form of dystonia, a disorder defined by the presence of sustained involuntary muscle contraction, often leading to abnormal postures. DYT33 is a slowly progressive form characterized by onset of focal or generalized dystonia in the first decades of life. Disease manifestations are variable. Some patients show ambulation difficulties, dysarthria, or dysphagia. Some affected individuals may manifest motor delay, lower limb spasticity, and mild developmental delay with intellectual disability. DYT33 penetrance is incomplete. Inheritance can be autosomal dominant or recessive. {ECO:0000269|PubMed:33236446, ECO:0000269|PubMed:33866603, ECO:0000269|PubMed:35146068}. Note=The disease is caused by variants affecting the gene represented in this entry.
DE  Reference Proteome: Yes;
DE  Interaction: O75569; IntAct: EBI-6116026; Score: 0.80
DE  Interaction: O92972; IntAct: EBI-6918687; Score: 0.40
DE  Interaction: P60953; IntAct: EBI-8612632; Score: 0.44
DE  Interaction: P62999; IntAct: EBI-8612643; Score: 0.44
DE  Interaction: Q27968; IntAct: EBI-640789; Score: 0.59
DE  Interaction: P06748; IntAct: EBI-6958371; Score: 0.46
DE  Interaction: Q9UJU6; IntAct: EBI-1080906; Score: 0.00
DE  Interaction: P05198; IntAct: EBI-1226418; Score: 0.78
DE  Interaction: P20639; IntAct: EBI-8674959; Score: 0.67
DE  Interaction: P35570; IntAct: EBI-2603511; Score: 0.44
DE  Interaction: P06493; IntAct: EBI-7909622; Score: 0.44
DE  Interaction: P60520; IntAct: EBI-3046676; Score: 0.35
DE  Interaction: Q96C10; IntAct: EBI-6115711; Score: 0.50
DE  Interaction: Q8IY81; IntAct: EBI-6116026; Score: 0.62
DE  Interaction: P05455; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: P46087; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: Q9HCE1; IntAct: EBI-6116026; Score: 0.62
DE  Interaction: O00458; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: Q99848; IntAct: EBI-6116026; Score: 0.53
DE  Interaction: P07910; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: P56537; IntAct: EBI-6116026; Score: 0.50
DE  Interaction: Q13310; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: Q9NUL3; IntAct: EBI-6116026; Score: 0.62
DE  Interaction: Q9NZM5; IntAct: EBI-6116026; Score: 0.53
DE  Interaction: Q9BZE4; IntAct: EBI-6116026; Score: 0.53
DE  Interaction: Q9H0E2; IntAct: EBI-6116026; Score: 0.50
DE  Interaction: Q7L2E3; IntAct: EBI-6116026; Score: 0.71
DE  Interaction: Q9H0D6; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: P20248; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: Q9NSD9; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: O95793; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: O60812; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: Q8WTT2; IntAct: EBI-6116026; Score: 0.53
DE  Interaction: Q9UPY3; IntAct: EBI-6116026; Score: 0.50
DE  Interaction: Q9NX58; IntAct: EBI-6116026; Score: 0.53
DE  Interaction: Q8N5Z5; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: Q96CT7; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: Q00577; IntAct: EBI-6116026; Score: 0.53
DE  Interaction: P36873; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: Q15633; IntAct: EBI-6116026; Score: 0.50
DE  Interaction: Q6P2E9; IntAct: EBI-6116026; Score: 0.50
DE  Interaction: Q9Y285; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: Q9UL40; IntAct: EBI-6116026; Score: 0.62
DE  Interaction: P16403; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: Q00526; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: P11387; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: Q9BVP2; IntAct: EBI-6116026; Score: 0.35
DE  Interaction: Q08211; IntAct: EBI-6116026; Score: 0.50
DE  Interaction: P04591; IntAct: EBI-6178285; Score: 0.40
DE  Interaction: O00425; IntAct: EBI-6255714; Score: 0.35
DE  Interaction: Q9Y6M1; IntAct: EBI-6255714; Score: 0.35
DE  Interaction: P08238; IntAct: EBI-6424177; Score: 0.40
DE  Interaction: Q86VP6; IntAct: EBI-21322532; Score: 0.35
DE  Interaction: Q13618; IntAct: EBI-21329068; Score: 0.35
DE  Interaction: P04487; IntAct: EBI-6880922; Score: 0.59
DE  Interaction: P27958; IntAct: EBI-8765629; Score: 0.70
DE  Interaction: Q16543; IntAct: EBI-8770673; Score: 0.35
DE  Interaction: Q2HR71; IntAct: EBI-8876191; Score: 0.40
DE  Interaction: P05412; IntAct: EBI-11324725; Score: 0.35
DE  Interaction: Q96FF9; IntAct: EBI-11027063; Score: 0.35
DE  Interaction: P27635; IntAct: EBI-11035646; Score: 0.35
DE  Interaction: Q99PL5; IntAct: EBI-11066888; Score: 0.35
DE  Interaction: Q14108; IntAct: EBI-11072280; Score: 0.35
DE  Interaction: Q6PFD6; IntAct: EBI-11093571; Score: 0.35
DE  Interaction: Q6PJG2; IntAct: EBI-11106137; Score: 0.35
DE  Interaction: Q9H444; IntAct: EBI-11151252; Score: 0.35
DE  Interaction: P78563; IntAct: EBI-25249266; Score: 0.56
DE  Interaction: P51608; IntAct: EBI-21532962; Score: 0.35
DE  Interaction: Q96SL4; IntAct: EBI-21714987; Score: 0.35
DE  Interaction: Q8N6M8; IntAct: EBI-21771054; Score: 0.35
DE  Interaction: P04798; IntAct: EBI-21774067; Score: 0.35
DE  Interaction: Q60803; IntAct: EBI-15560282; Score: 0.40
DE  Interaction: P53235; IntAct: EBI-15561786; Score: 0.44
DE  Interaction: P19525; IntAct: EBI-15561809; Score: 0.56
DE  Interaction: Q96P20; IntAct: EBI-15999105; Score: 0.60
DE  Interaction: O14862; IntAct: EBI-15999033; Score: 0.40
DE  Interaction: Q9C000; IntAct: EBI-15999201; Score: 0.40
DE  Interaction: Q9NPP4; IntAct: EBI-15999262; Score: 0.40
DE  Interaction: Q14684; IntAct: EBI-16686997; Score: 0.53
DE  Interaction: Q7KZN9; IntAct: EBI-20304305; Score: 0.35
DE  Interaction: P09622; IntAct: EBI-20304669; Score: 0.35
DE  Interaction: P36957; IntAct: EBI-20305285; Score: 0.35
DE  Interaction: P10636; IntAct: EBI-20798291; Score: 0.35
DE  Interaction: Q15628; IntAct: EBI-20936084; Score: 0.40
DE  Interaction: Q5S007; IntAct: EBI-21360986; Score: 0.35
DE  Interaction: P03372; IntAct: EBI-21301141; Score: 0.35
DE  Interaction: Q9UN86; IntAct: EBI-26877955; Score: 0.40
DE  Interaction: Q13283; IntAct: EBI-26877944; Score: 0.53
DE  Interaction: P0DTC9; IntAct: EBI-26948583; Score: 0.82
DE  Interaction: P59595; IntAct: EBI-26984718; Score: 0.40
DE  Interaction: K9N4V7; IntAct: EBI-26984727; Score: 0.40
DE  Interaction: Q9BY44; IntAct: EBI-26989881; Score: 0.40
DE  Interaction: P35226; IntAct: EBI-27109494; Score: 0.35
DE  Interaction: Q9Y4W2; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9Y3T9; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9Y3C1; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9Y3B9; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9UKM9; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9UKD2; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9NW13; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9NVP1; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9NQ55; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9H7B2; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9H0A0; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9GZR7; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9BYG3; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9BU76; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q9BRT6; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q99459; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q96SI9; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q96SB4; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q96KR1; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q96GQ7; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q96B26; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q8WTW3; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q8TDD1; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q8N9T8; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q8IZL8; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q1KMD3; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q15024; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q14690; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q14146; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q14137; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q13823; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q13523; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q12906; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q03701; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: Q01780; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: P55265; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: P51116; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: P30048; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: O95478; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: O75683; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: O60832; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: O60287; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: O43159; IntAct: EBI-28934478; Score: 0.35
DE  Interaction: O15226; IntAct: EBI-28934478; Score: 0.35
GO  GO:0005737;
GO  GO:0005829;
GO  GO:0016020;
GO  GO:0005634;
GO  GO:0048471;
GO  GO:0005840;
GO  GO:0005524;
GO  GO:0003725;
GO  GO:0004694;
GO  GO:0042802;
GO  GO:0004715;
GO  GO:0004672;
GO  GO:0019888;
GO  GO:0106310;
GO  GO:0004674;
GO  GO:0003723;
GO  GO:0034198;
GO  GO:0051607;
GO  GO:0030968;
GO  GO:0045087;
GO  GO:0043066;
GO  GO:0008285;
GO  GO:0033689;
GO  GO:0017148;
GO  GO:0045071;
GO  GO:0032722;
GO  GO:0001819;
GO  GO:0043410;
GO  GO:0051092;
GO  GO:1901224;
GO  GO:0032874;
GO  GO:0046777;
GO  GO:0006468;
GO  GO:1901532;
GO  GO:1902036;
GO  GO:1902033;
GO  GO:1900225;
GO  GO:0035455;
GO  GO:0009615;
GO  GO:0006412;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKK
SQ  AVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKL
SQ  AYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
SQ  RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNI
SQ  VHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITK
SQ  GVDYIHSKKLIHRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE
SQ  LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC
//