ID  P20240;
PN  Otefin;
GN  Ote;
OS  7227;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0179;
SL  Nucleus Position: SL-0182;
SL  Comments: Nucleus inner membrane {ECO:0000269|PubMed:16439308, ECO:0000269|PubMed:18410727, ECO:0000269|PubMed:22751930, ECO:0000269|PubMed:2517292, ECO:0000269|PubMed:27174470, ECO:0000269|PubMed:8999964, ECO:0000269|PubMed:9199347, ECO:0000269|PubMed:9632815}; Peripheral membrane protein {ECO:0000269|PubMed:2517292, ECO:0000269|PubMed:8999964, ECO:0000269|PubMed:9199347}; Nucleoplasmic side {ECO:0000269|PubMed:2517292}. Nucleus, nucleoplasm {ECO:0000269|PubMed:8999964}. Cytoplasm {ECO:0000269|PubMed:22751930, ECO:0000269|PubMed:9199347}. Chromosome {ECO:0000269|PubMed:22751930, ECO:0000269|PubMed:2517292}. Cytoplasm, cytoskeleton, spindle pole {ECO:0000269|PubMed:16439308, ECO:0000269|PubMed:2186029, ECO:0000269|PubMed:22751930}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000269|PubMed:22751930}. Note=Component of the spindle envelope during early mitotic cycles (PubMed:2186029, PubMed:2517292). Following nuclear envelope breakdown, becomes dispersed in the cytoplasm and concentrated at the spindle poles (PubMed:22751930, PubMed:2517292). At anaphase (when the nuclear envelope begins to reassemble), locates to the chromosomes accumulating first in areas adjacent to centrosomes and at the peripheral sites of the chromosomes (PubMed:22751930, PubMed:2517292). At telophase, expressed as a continuous rim around the chromatin and increased expression in the midspindle area (PubMed:22751930). During cytokinesis, locates to the nuclear periphery with some remaining in the cytoplasm and at the mid-body (PubMed:22751930). At stage 4 of egg development, expression in the oocyte nuclear envelope is higher than in the nurse nuclear envelope (PubMed:9199347). Expression in oocyte cytoplasm increases after stages 6 to 7 of egg development (PubMed:9199347). {ECO:0000269|PubMed:2186029, ECO:0000269|PubMed:22751930, ECO:0000269|PubMed:2517292, ECO:0000269|PubMed:9199347}.
DR  UNIPROT: P20240;
DR  UNIPROT: Q9V8E5;
DR  Pfam: PF03020;
DR  PROSITE: PS50954;
DE  Function: Inner nuclear membrane protein (PubMed:2186029, PubMed:9199347, PubMed:18410727, PubMed:22751930). Involved in the attachment of membrane vesicles to chromatin during nuclear assembly, and is probably required for centrosome maturation and cell cycle progression during mitosis (PubMed:9199347, PubMed:22751930). Essential for differentiation of certain tissues and the maintenance of progenitor cell populations (PubMed:18410727, PubMed:24700158, PubMed:23806619, PubMed:27174470). Required for the differentiation and maintenance of male and female germline stem cells (GSCs), as well as the maintenance of somatic cells in the GSC niche (PubMed:18410727, PubMed:23806619, PubMed:27174470). This role is likely to be independent of the BMP (Dpp) pathway that negatively regulates bam transcription during GSC differentiation (PubMed:18410727, PubMed:23806619). During development, plays essential and redundant functions with the other LEM domain proteins; bocks and MAN1 (PubMed:24700158). Also has a redundant but important role with bocks during larval development (PubMed:24700158). {ECO:0000269|PubMed:18410727, ECO:0000269|PubMed:2186029, ECO:0000269|PubMed:22751930, ECO:0000269|PubMed:23806619, ECO:0000269|PubMed:24700158, ECO:0000269|PubMed:27174470, ECO:0000269|PubMed:9199347}.
DE  Reference Proteome: Yes;
DE  Interaction: P08928; IntAct: EBI-873490; Score: 0.50
DE  Interaction: Q94524; IntAct: EBI-221780; Score: 0.00
DE  Interaction: P23572; IntAct: EBI-871822; Score: 0.27
DE  Interaction: P92177; IntAct: EBI-8283416; Score: 0.35
DE  Interaction: Q24568; IntAct: EBI-9944837; Score: 0.35
DE  Interaction: Q9VHX7; IntAct: EBI-26718525; Score: 0.49
DE  Interaction: A2VEE1; IntAct: EBI-26718505; Score: 0.49
DE  Interaction: Q9I7U2; IntAct: EBI-26718495; Score: 0.49
DE  Interaction: Q8SXS4; IntAct: EBI-26718485; Score: 0.49
DE  Interaction: Q9VPB8; IntAct: EBI-26718475; Score: 0.49
DE  Interaction: Q9VV87; IntAct: EBI-26718465; Score: 0.49
DE  Interaction: Q9V3Q9; IntAct: EBI-26718455; Score: 0.49
DE  Interaction: Q4V4P2; IntAct: EBI-26718515; Score: 0.49
GO  GO:0005694;
GO  GO:0005737;
GO  GO:0012505;
GO  GO:0005815;
GO  GO:0005641;
GO  GO:0005637;
GO  GO:0031965;
GO  GO:0034399;
GO  GO:0005654;
GO  GO:0000922;
GO  GO:0003714;
GO  GO:0008134;
GO  GO:0007049;
GO  GO:0051301;
GO  GO:0030718;
GO  GO:0060250;
GO  GO:0045892;
GO  GO:0031468;
GO  GO:0048477;
GO  GO:0030513;
TP  Membrane Topology: Peripheral; Source: UniProt - Sequence Analysis;
SQ  MADVDDFDSLSNAELRAKMLAQGLPNIPVTDSSRKVLVKRLRASIGGQASPAASPKKTNRRETLAPAPGAPSAPAAASTP
SQ  VDKLDGNKVAPATKARRTITAAEAKEPVRRLPEEAIRRRPDEADRLRSEEPVAARKPTTAPAAQPVQTRRTSTSSGSERK
SQ  VVEPLRKPETIVEQPASSKRADREENYLKVNSLIVLESDEEEDEQLVQAADLVEQEHAARQKTTKLASSGTTTYEYKSKV
SQ  VEPPRRQVYEATAAPVLPPSVPSARAQTTSSTRSYDYASNPAPGRYSSFVRTAAQGYVTAEAPPVASYSSSYKRTYANEL
SQ  SDDTDSKEDQYESTFARNLARLRAERIGDRISPYSRRTLASGNAGSGSLGYEPRARRSLRPNDNSVSEAFNRWLNSLEQK
SQ  YHIKSKLFIVLLVLLLIGVYYIFY
//