ID P20292; PN Arachidonate 5-lipoxygenase-activating protein; GN ALOX5AP; OS 9606; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. DR UNIPROT: P20292; DR UNIPROT: Q5VV04; DR PDB: 2Q7M; DR PDB: 2Q7R; DR PDB: 6VGC; DR PDB: 6VGI; DR Pfam: PF01124; DR PROSITE: PS01297; DR OMIM: 601367; DR OMIM: 603700; DR DisGeNET: 241; DE Function: Required for leukotriene biosynthesis by ALOX5 (5- lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes. {ECO:0000269|PubMed:2300173, ECO:0000269|PubMed:8440384}. DE Disease: Ischemic stroke (ISCHSTR) [MIM:601367]: A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors. Note=Disease susceptibility is associated with variants affecting the gene represented in this entry. Note=Genetic variations in ALOX5AP may be associated with susceptibility to myocardial infarction. Involvement in myocardial infarction is however unclear: according to some authors (PubMed:14770184), a 4-SNP haplotype in ALOX5AP confers risk of myocardial infarction, while according to other (PubMed:17304054) ALOX5AP is not implicated in this condition. {ECO:0000269|PubMed:14770184, ECO:0000269|PubMed:17304054}. DE Reference Proteome: Yes; DE Interaction: A0PK00; IntAct: EBI-24765164; Score: 0.56 DE Interaction: O00299; IntAct: EBI-3904626; Score: 0.37 DE Interaction: Q9H115; IntAct: EBI-24738406; Score: 0.56 DE Interaction: Q96FB2; IntAct: EBI-24768960; Score: 0.56 DE Interaction: O15529; IntAct: EBI-24778364; Score: 0.56 DE Interaction: P35372; IntAct: EBI-24571720; Score: 0.56 DE Interaction: Q13520; IntAct: EBI-24799898; Score: 0.56 DE Interaction: O15552; IntAct: EBI-24808129; Score: 0.56 DE Interaction: Q70Z53; IntAct: EBI-21893005; Score: 0.40 DE Interaction: P20292; IntAct: EBI-26452342; Score: 0.40 GO GO:0005829; GO GO:0005783; GO GO:0005789; GO GO:0016021; GO GO:0016020; GO GO:0005635; GO GO:0031965; GO GO:0004051; GO GO:0050544; GO GO:0008047; GO GO:0019899; GO GO:0004602; GO GO:0004364; GO GO:0042802; GO GO:0004464; GO GO:0047485; GO GO:0044877; GO GO:0071277; GO GO:0019370; GO GO:0002540; GO GO:0019372; GO GO:0002675; GO GO:0070207; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis; SQ MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQ SQ VPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLI SQ P //