ID  P22147;
PN  5'-3' exoribonuclease 1;
GN  XRN1;
OS  559292;
SL  Nucleus Position: SL-0198;
SL  Comments: Cytoplasm. Cytoplasm, perinuclear region. Cytoplasm, P-body.
DR  UNIPROT: P22147;
DR  UNIPROT: D6VTX9;
DR  PDB: 6Q8Y;
DR  Pfam: PF18129;
DR  Pfam: PF18332;
DR  Pfam: PF18334;
DR  Pfam: PF18194;
DR  Pfam: PF17846;
DR  Pfam: PF03159;
DE  Function: Multifunctional protein that exhibits several independent functions at different levels of the cellular processes. 5'-3' exonuclease component of the nonsense-mediated mRNA decay (NMD) which is a highly conserved mRNA degradation pathway, an RNA surveillance system whose role is to identify and rid cells of mRNA with premature termination codons and thus prevents accumulation of potentially harmful truncated proteins. The NMD pathway has a second role regulating the decay of wild-type mRNAs, and especially mRNAs that are important for telomere functions. Participate in CTH2-mediated and VTS1-mediated mRNA turnover. Involved in the degradation of several hypomodified mature tRNA species and participates in the 5'-processing or the degradation of the snoRNA precursors and rRNA processing. Involved in defense against virus and suppresses viral RNA recombination by rapidly removing the 5'-truncated RNAs, the substrates of recombination, and thus reducing the chance for recombination to occur in the parental strain. Required for the assembly of the virus- like particles of the Ty3 retrotransposon and contributes to the efficient generation of narnavirus 20S RNA by playing a major role in the elimination of the non-viral upstream sequences from the primary transcripts. Degrades single-stranded DNA (ss-DNA) and can renature complementary ss-DNA as well as catalyzes the formation of heteroduplex DNA from circular ss-DNA and homologous linear ds-DNA in vitro. Acts as a microtubule-associated protein which interacts with cytoplasmic microtubules through beta-tubulin and promotes in vitro assembly of tubulin into microtubules. Associates with microtubule functions such as chromosome transmission, nuclear migration, and SPB duplication. Has also a role in G1 to S transition and is involved in nuclear fusion during karyogamy. Required for the expression of ROK1 at the post- transcriptional level and for the alpha-factor induction of the karyogamy genes KAR3 and KAR4. Plays a role in filamentous growth. {ECO:0000269|PubMed:10454540, ECO:0000269|PubMed:11142370, ECO:0000269|PubMed:11238889, ECO:0000269|PubMed:11910109, ECO:0000269|PubMed:12423748, ECO:0000269|PubMed:12799443, ECO:0000269|PubMed:12853617, ECO:0000269|PubMed:14561886, ECO:0000269|PubMed:14690598, ECO:0000269|PubMed:14729943, ECO:0000269|PubMed:15013450, ECO:0000269|PubMed:15358132, ECO:0000269|PubMed:15967792, ECO:0000269|PubMed:15989963, ECO:0000269|PubMed:16240118, ECO:0000269|PubMed:16373495, ECO:0000269|PubMed:16501073, ECO:0000269|PubMed:16714281, ECO:0000269|PubMed:16885161, ECO:0000269|PubMed:17761681, ECO:0000269|PubMed:18162578, ECO:0000269|PubMed:18443146, ECO:0000269|PubMed:18469165, ECO:0000269|PubMed:18640978, ECO:0000269|PubMed:18676807, ECO:0000269|PubMed:18715869, ECO:0000269|PubMed:19324962, ECO:0000269|PubMed:2076815, ECO:0000269|PubMed:7597069, ECO:0000269|PubMed:7926736, ECO:0000269|PubMed:9315672, ECO:0000269|PubMed:9482746, ECO:0000269|PubMed:9488433, ECO:0000269|PubMed:9685486, ECO:0000269|PubMed:9742129}.
DE  Reference Proteome: Yes;
DE  Interaction: P20484; IntAct: EBI-16273123; Score: 0.35
DE  Interaction: P38203; IntAct: EBI-7341346; Score: 0.68
DE  Interaction: P40070; IntAct: EBI-7344118; Score: 0.68
DE  Interaction: P47093; IntAct: EBI-7347117; Score: 0.57
DE  Interaction: P53550; IntAct: EBI-7348887; Score: 0.55
DE  Interaction: P40073; IntAct: EBI-601178; Score: 0.37
DE  Interaction: P34230; IntAct: EBI-7095564; Score: 0.57
DE  Interaction: P53235; IntAct: EBI-7100035; Score: 0.70
DE  Interaction: P40089; IntAct: EBI-7101552; Score: 0.69
DE  Interaction: Q06406; IntAct: EBI-7101566; Score: 0.69
DE  Interaction: P57743; IntAct: EBI-7101614; Score: 0.69
DE  Interaction: P22147; IntAct: EBI-7101661; Score: 0.40
DE  Interaction: P47017; IntAct: EBI-7103424; Score: 0.69
DE  Interaction: P06634; IntAct: EBI-7107258; Score: 0.40
DE  Interaction: P15646; IntAct: EBI-7107862; Score: 0.40
DE  Interaction: P50095; IntAct: EBI-785746; Score: 0.35
DE  Interaction: P28007; IntAct: EBI-785796; Score: 0.35
DE  Interaction: P53917; IntAct: EBI-785875; Score: 0.35
DE  Interaction: P53131; IntAct: EBI-786246; Score: 0.53
DE  Interaction: Q07508; IntAct: EBI-786510; Score: 0.35
DE  Interaction: Q03782; IntAct: EBI-787666; Score: 0.35
DE  Interaction: P53617; IntAct: EBI-787885; Score: 0.35
DE  Interaction: P36520; IntAct: EBI-789484; Score: 0.35
DE  Interaction: P25644; IntAct: EBI-789578; Score: 0.67
DE  Interaction: P07347; IntAct: EBI-789752; Score: 0.35
DE  Interaction: P39935; IntAct: EBI-789934; Score: 0.35
DE  Interaction: P33759; IntAct: EBI-790057; Score: 0.35
DE  Interaction: P07260; IntAct: EBI-791281; Score: 0.61
DE  Interaction: Q12339; IntAct: EBI-792168; Score: 0.35
DE  Interaction: Q12180; IntAct: EBI-792644; Score: 0.35
DE  Interaction: P38112; IntAct: EBI-792768; Score: 0.35
DE  Interaction: P39730; IntAct: EBI-793125; Score: 0.35
DE  Interaction: Q12230; IntAct: EBI-793227; Score: 0.56
DE  Interaction: P50094; IntAct: EBI-793313; Score: 0.35
DE  Interaction: Q00539; IntAct: EBI-793423; Score: 0.35
DE  Interaction: P41544; IntAct: EBI-795171; Score: 0.35
DE  Interaction: P06102; IntAct: EBI-796052; Score: 0.35
DE  Interaction: P21954; IntAct: EBI-796109; Score: 0.35
DE  Interaction: P38199; IntAct: EBI-796822; Score: 0.35
DE  Interaction: P37838; IntAct: EBI-796980; Score: 0.35
DE  Interaction: P36160; IntAct: EBI-797509; Score: 0.35
DE  Interaction: P28003; IntAct: EBI-797693; Score: 0.35
DE  Interaction: P04912; IntAct: EBI-798033; Score: 0.35
DE  Interaction: P10080; IntAct: EBI-798100; Score: 0.56
DE  Interaction: P53883; IntAct: EBI-798461; Score: 0.67
DE  Interaction: P53849; IntAct: EBI-800556; Score: 0.35
DE  Interaction: P07280; IntAct: EBI-801098; Score: 0.35
DE  Interaction: P39735; IntAct: EBI-801128; Score: 0.35
DE  Interaction: P32588; IntAct: EBI-801532; Score: 0.35
DE  Interaction: P39928; IntAct: EBI-801843; Score: 0.35
DE  Interaction: P38934; IntAct: EBI-801975; Score: 0.35
DE  Interaction: P38996; IntAct: EBI-802165; Score: 0.35
DE  Interaction: P42846; IntAct: EBI-803913; Score: 0.35
DE  Interaction: P46677; IntAct: EBI-804533; Score: 0.35
DE  Interaction: P33322; IntAct: EBI-804949; Score: 0.61
DE  Interaction: P39998; IntAct: EBI-805615; Score: 0.35
DE  Interaction: P38789; IntAct: EBI-805875; Score: 0.35
DE  Interaction: P32495; IntAct: EBI-807147; Score: 0.35
DE  Interaction: P39715; IntAct: EBI-807214; Score: 0.35
DE  Interaction: P53730; IntAct: EBI-807951; Score: 0.35
DE  Interaction: P51998; IntAct: EBI-809221; Score: 0.35
DE  Interaction: P27476; IntAct: EBI-809258; Score: 0.35
DE  Interaction: P31334; IntAct: EBI-809484; Score: 0.35
DE  Interaction: P46995; IntAct: EBI-810191; Score: 0.35
DE  Interaction: P38217; IntAct: EBI-810745; Score: 0.35
DE  Interaction: P11484; IntAct: EBI-811410; Score: 0.53
DE  Interaction: P10592; IntAct: EBI-811410; Score: 0.53
DE  Interaction: Q12517; IntAct: EBI-811410; Score: 0.44
DE  Interaction: P53905; IntAct: EBI-811492; Score: 0.56
DE  Interaction: P32357; IntAct: EBI-812552; Score: 0.27
DE  Interaction: P20448; IntAct: EBI-817592; Score: 0.27
DE  Interaction: P07246; IntAct: EBI-818223; Score: 0.27
DE  Interaction: P23293; IntAct: EBI-818581; Score: 0.53
DE  Interaction: P32493; IntAct: EBI-819907; Score: 0.27
DE  Interaction: P07270; IntAct: EBI-821981; Score: 0.35
DE  Interaction: P14680; IntAct: EBI-822301; Score: 0.35
DE  Interaction: Q04264; IntAct: EBI-822895; Score: 0.35
DE  Interaction: P36103; IntAct: EBI-7163764; Score: 0.40
DE  Interaction: P14682; IntAct: EBI-7232905; Score: 0.40
DE  Interaction: P35207; IntAct: EBI-7383410; Score: 0.40
DE  Interaction: P07703; IntAct: EBI-7383484; Score: 0.56
DE  Interaction: Q12159; IntAct: EBI-7383752; Score: 0.40
DE  Interaction: P39015; IntAct: EBI-7383874; Score: 0.40
DE  Interaction: P53252; IntAct: EBI-7383909; Score: 0.40
DE  Interaction: Q02793; IntAct: EBI-7702127; Score: 0.40
DE  Interaction: P39517; IntAct: EBI-969682; Score: 0.35
DE  Interaction: Q03758; IntAct: EBI-2611184; Score: 0.35
DE  Interaction: Q06098; IntAct: EBI-2612191; Score: 0.35
DE  Interaction: P32350; IntAct: EBI-2612391; Score: 0.35
DE  Interaction: P36002; IntAct: EBI-2613197; Score: 0.35
DE  Interaction: Q02981; IntAct: EBI-2614446; Score: 0.35
DE  Interaction: Q01389; IntAct: EBI-2616771; Score: 0.35
DE  Interaction: Q01477; IntAct: EBI-7992250; Score: 0.35
DE  Interaction: P53741; IntAct: EBI-7994013; Score: 0.35
DE  Interaction: P10591; IntAct: EBI-3671884; Score: 0.53
DE  Interaction: P39987; IntAct: EBI-3702683; Score: 0.35
DE  Interaction: P32589; IntAct: EBI-3726158; Score: 0.35
DE  Interaction: P33416; IntAct: EBI-3745115; Score: 0.35
DE  Interaction: P53940; IntAct: EBI-3768410; Score: 0.35
DE  Interaction: P38788; IntAct: EBI-3790303; Score: 0.35
DE  Interaction: P02829; IntAct: EBI-3812207; Score: 0.35
DE  Interaction: P39523; IntAct: EBI-9976090; Score: 0.35
DE  Interaction: P30822; IntAct: EBI-11611503; Score: 0.35
DE  Interaction: P38328; IntAct: EBI-16264031; Score: 0.35
DE  Interaction: P46947; IntAct: EBI-16264615; Score: 0.35
DE  Interaction: P32458; IntAct: EBI-16265446; Score: 0.35
DE  Interaction: P15790; IntAct: EBI-16266738; Score: 0.35
DE  Interaction: Q03957; IntAct: EBI-16267608; Score: 0.35
DE  Interaction: Q08496; IntAct: EBI-16268078; Score: 0.35
DE  Interaction: P53861; IntAct: EBI-16268602; Score: 0.35
DE  Interaction: P17214; IntAct: EBI-16268957; Score: 0.35
DE  Interaction: P40466; IntAct: EBI-16269181; Score: 0.35
DE  Interaction: P32828; IntAct: EBI-16270661; Score: 0.35
DE  Interaction: P04911; IntAct: EBI-16271323; Score: 0.35
DE  Interaction: P32464; IntAct: EBI-16271424; Score: 0.35
DE  Interaction: P40055; IntAct: EBI-16272037; Score: 0.35
DE  Interaction: P22134; IntAct: EBI-16273066; Score: 0.35
DE  Interaction: P27705; IntAct: EBI-16273814; Score: 0.35
DE  Interaction: Q04149; IntAct: EBI-16274484; Score: 0.35
DE  Interaction: Q12236; IntAct: EBI-16275897; Score: 0.35
DE  Interaction: P32345; IntAct: EBI-16276178; Score: 0.35
DE  Interaction: Q07350; IntAct: EBI-16276475; Score: 0.35
DE  Interaction: P30620; IntAct: EBI-16276950; Score: 0.35
DE  Interaction: P34221; IntAct: EBI-16277075; Score: 0.35
DE  Interaction: Q04049; IntAct: EBI-16278245; Score: 0.35
DE  Interaction: P14291; IntAct: EBI-16279138; Score: 0.35
DE  Interaction: P38987; IntAct: EBI-16285008; Score: 0.35
DE  Interaction: P53632; IntAct: EBI-16285647; Score: 0.35
DE  Interaction: Q07623; IntAct: EBI-16287594; Score: 0.35
DE  Interaction: Q05580; IntAct: EBI-16288023; Score: 0.35
DE  Interaction: Q06344; IntAct: EBI-16288282; Score: 0.35
DE  Interaction: P53261; IntAct: EBI-16289064; Score: 0.35
DE  Interaction: P38779; IntAct: EBI-16289300; Score: 0.35
DE  Interaction: P36009; IntAct: EBI-16290060; Score: 0.35
DE  Interaction: Q06436; IntAct: EBI-16291315; Score: 0.35
DE  Interaction: Q04305; IntAct: EBI-16291624; Score: 0.35
DE  Interaction: P42843; IntAct: EBI-16291990; Score: 0.35
DE  Interaction: Q00416; IntAct: EBI-16421063; Score: 0.35
DE  Interaction: P14772; IntAct: EBI-20813827; Score: 0.37
DE  Interaction: P41909; IntAct: EBI-20815489; Score: 0.37
GO  GO:0005737;
GO  GO:0010494;
GO  GO:0005829;
GO  GO:0090512;
GO  GO:0005874;
GO  GO:0005634;
GO  GO:0000932;
GO  GO:0048471;
GO  GO:0004534;
GO  GO:0003682;
GO  GO:0031370;
GO  GO:0003729;
GO  GO:0003723;
GO  GO:0000741;
GO  GO:0061157;
GO  GO:0016242;
GO  GO:0070651;
GO  GO:0000956;
GO  GO:0070479;
GO  GO:0000184;
GO  GO:0032968;
GO  GO:0060261;
GO  GO:0016075;
GO  GO:0006364;
GO  GO:0043144;
GO  GO:0006413;
GO  GO:0007089;
GO  GO:0016078;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MGIPKFFRYISERWPMILQLIEGTQIPEFDNLYLDMNSILHNCTHGNDDDVTKRLTEEEVFAKICTYIDHLFQTIKPKKI
SQ  FYMAIDGVAPRAKMNQQRARRFRTAMDAEKALKKAIENGDEIPKGEPFDSNSITPGTEFMAKLTKNLQYFIHDKISNDSK
SQ  WREVQIIFSGHEVPGEGEHKIMNFIRHLKSQKDFNQNTRHCIYGLDADLIMLGLSTHGPHFALLREEVTFGRRNSEKKSL
SQ  EHQNFYLLHLSLLREYMELEFKEIADEMQFEYNFERILDDFILVMFVIGNDFLPNLPDLHLNKGAFPVLLQTFKEALLHT
SQ  DGYINEHGKINLKRLGVWLNYLSQFELLNFEKDDIDVEWFNKQLENISLEGERKRQRVGKKLLVKQQKKLIGSIKPWLME
SQ  QLQEKLSPDLPDEEIPTLELPKDLDMKDHLEFLKEFAFDLGLFITHSKSKGSYSLKMDLDSINPDETEEEFQNRVNSIRK
SQ  TIKKYQNAIIVEDKEELETEKTIYNERFERWKHEYYHDKLKFTTDSEEKVRDLAKDYVEGLQWVLYYYYRGCPSWSWYYP
SQ  HHYAPRISDLAKGLDQDIEFDLSKPFTPFQQLMAVLPERSKNLIPPAFRPLMYDEQSPIHDFYPAEVQLDKNGKTADWEA
SQ  VVLISFVDEKRLIEAMQPYLRKLSPEEKTRNQFGKDLIYSFNPQVDNLYKSPLGGIFSDIEHNHCVEKEYITIPLDSSEI
SQ  RYGLLPNAKLGAEMLAGFPTLLSLPFTSSLEYNETMVFQQPSKQQSMVLQITDIYKTNNVTLEDFSKRHLNKVIYTRWPY
SQ  LRESKLVSLTDGKTIYEYQESNDKKKFGFITKPAETQDKKLFNSLKNSMLRMYAKQKAVKIGPMEAIATVFPVTGLVRDS
SQ  DGGYIKTFSPTPDYYPLQLVVESVVNEDERYKERGPIPIEEEFPLNSKVIFLGDYAYGGETTIDGYSSDRRLKITVEKKF
SQ  LDSEPTIGKERLQMDHQAVKYYPSYIVSKNMHLHPLFLSKITSKFMITDATGKHINVGIPVKFEARHQKVLGYARRNPRG
SQ  WEYSNLTLNLLKEYRQTFPDFFFRLSKVGNDIPVLEDLFPDTSTKDAMNLLDGIKQWLKYVSSKFIAVSLESDSLTKTSI
SQ  AAVEDHIMKYAANIEGHERKQLAKVPREAVLNPRSSFALLRSQKFDLGDRVVYIQDSGKVPIFSKGTVVGYTTLSSSLSI
SQ  QVLFDHEIVAGNNFGGRLRTNRGLGLDASFLLNITNRQFIYHSKASKKALEKKKQSNNRNNNTKTAHKTPSKQQSEEKLR
SQ  KERAHDLLNFIKKDTNEKNSESVDNKSMGSQKDSKPAKKVLLKRPAQKSSENVQVDLANFEKAPLDNPTVAGSIFNAVAN
SQ  QYSDGIGSNLNIPTPPHPMNVVGGPIPGANDVADVGLPYNIPPGFMTHPNGLHPLHPHQMPYPNMNGMSIPPPAPHGFGQ
SQ  PISFPPPPPMTNVSDQGSRIVVNEKESQDLKKFINGKQHSNGSTIGGETKNSRKGEIKPSSGTNSTECQSPKSQSNAADR
SQ  DNKKDEST
//