ID  P25322;
PN  G1/S-specific cyclin-D1;
GN  Ccnd1;
OS  10090;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0182;
SL  Comments: Nucleus {ECO:0000269|PubMed:19767775}. Cytoplasm {ECO:0000250|UniProtKB:P24385}. Nucleus membrane {ECO:0000250|UniProtKB:P24385}. Note=Cyclin D-CDK4 complexes accumulate at the nuclear membrane and are then translocated into the nucleus through interaction with KIP/CIP family members. {ECO:0000250|UniProtKB:P24385}.
DR  UNIPROT: P25322;
DR  Pfam: PF02984;
DR  Pfam: PF00134;
DR  PROSITE: PS00292;
DE  Function: Regulatory component of the cyclin D1-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also a substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D1/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex. Exhibits transcriptional corepressor activity with INSM1 on the NEUROD1 and INS promoters in a cell cycle-independent manner. {ECO:0000250|UniProtKB:P24385}.
DE  Reference Proteome: Yes;
DE  Interaction: P30285; IntAct: EBI-1005778; Score: 0.94
DE  Interaction: Q64261; IntAct: EBI-1005805; Score: 0.35
DE  Interaction: P46414; IntAct: EBI-1005805; Score: 0.35
DE  Interaction: P97377; IntAct: EBI-1005805; Score: 0.35
DE  Interaction: P63087; IntAct: EBI-1202844; Score: 0.00
DE  Interaction: Q99J09; IntAct: EBI-2939789; Score: 0.35
DE  Interaction: Q8CIG8; IntAct: EBI-2939789; Score: 0.61
DE  Interaction: O14744; IntAct: EBI-2941110; Score: 0.35
DE  Interaction: Q9BQA1; IntAct: EBI-2941649; Score: 0.40
DE  Interaction: P63321; IntAct: EBI-3956288; Score: 0.46
DE  Interaction: P11234; IntAct: EBI-3956307; Score: 0.40
DE  Interaction: Q6KAR6; IntAct: EBI-3956307; Score: 0.46
DE  Interaction: Q9JIW9; IntAct: EBI-3956328; Score: 0.27
DE  Interaction: P11233; IntAct: EBI-3956335; Score: 0.27
DE  Interaction: P09055; IntAct: EBI-3956355; Score: 0.27
DE  Interaction: Q62796; IntAct: EBI-3956408; Score: 0.40
DE  Interaction: Q01101; IntAct: EBI-9253124; Score: 0.35
DE  Interaction: O88895; IntAct: EBI-9253173; Score: 0.40
DE  Interaction: P13405; IntAct: EBI-11508299; Score: 0.40
DE  Interaction: Q9DBR0; IntAct: EBI-11602084; Score: 0.40
DE  Interaction: Q9WU00; IntAct: EBI-15593322; Score: 0.35
DE  Interaction: P11440; IntAct: EBI-15652518; Score: 0.40
GO  GO:0005923;
GO  GO:0097128;
GO  GO:0000307;
GO  GO:0005737;
GO  GO:0005829;
GO  GO:0031965;
GO  GO:0005654;
GO  GO:0005634;
GO  GO:0017053;
GO  GO:0016538;
GO  GO:0019899;
GO  GO:0042826;
GO  GO:0016301;
GO  GO:0070064;
GO  GO:0004672;
GO  GO:0019901;
GO  GO:0044877;
GO  GO:0003714;
GO  GO:0051301;
GO  GO:0008283;
GO  GO:0006974;
GO  GO:0071310;
GO  GO:0030968;
GO  GO:0045444;
GO  GO:0000082;
GO  GO:0007595;
GO  GO:0033327;
GO  GO:0097421;
GO  GO:0060749;
GO  GO:0033598;
GO  GO:0044772;
GO  GO:0031571;
GO  GO:0030857;
GO  GO:0043524;
GO  GO:0000122;
GO  GO:0030182;
GO  GO:0008284;
GO  GO:0045737;
GO  GO:1900087;
GO  GO:0010971;
GO  GO:0033601;
GO  GO:0001934;
GO  GO:0006468;
GO  GO:0000320;
GO  GO:0051726;
GO  GO:0000079;
GO  GO:2000045;
GO  GO:0051592;
GO  GO:0051412;
GO  GO:0032355;
GO  GO:0043627;
GO  GO:0045471;
GO  GO:0010039;
GO  GO:0044321;
GO  GO:0032026;
GO  GO:0010243;
GO  GO:0070141;
GO  GO:0033197;
GO  GO:0010165;
GO  GO:0009410;
GO  GO:0016055;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIVATWMLEVCEEQKCEEEVFPL
SQ  AMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDF
SQ  IEHFLSKMPEADENKQTIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCD
SQ  PDCLRACQEQIEALLESSLRQAQQNVDPKATEEEGEVEEEAGLACTPTDVRDVDI
//