ID  P30285;
PN  Cyclin-dependent kinase 4;
GN  Cdk4;
OS  10090;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0182;
SL  Comments: Cytoplasm {ECO:0000250|UniProtKB:P11802}. Nucleus {ECO:0000250|UniProtKB:P11802}. Nucleus membrane {ECO:0000250|UniProtKB:P11802}. Note=Cytoplasmic when non-complexed. Forms a cyclin D-CDK4 complex in the cytoplasm as cells progress through G(1) phase. The complex accumulates on the nuclear membrane and enters the nucleus on transition from G(1) to S phase. Also present in nucleoli and heterochromatin lumps. Colocalizes with RB1 after release into the nucleus (By similarity). {ECO:0000250|UniProtKB:P11802}.
DR  UNIPROT: P30285;
DR  Pfam: PF00069;
DR  PROSITE: PS00107;
DR  PROSITE: PS50011;
DR  PROSITE: PS00108;
DE  Function: Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (By similarity). {ECO:0000250}.
DE  Reference Proteome: Yes;
DE  Interaction: P24385; IntAct: EBI-6988572; Score: 0.40
DE  Interaction: P25322; IntAct: EBI-1005778; Score: 0.94
DE  Interaction: P30280; IntAct: EBI-1005844; Score: 0.53
DE  Interaction: P46414; IntAct: EBI-1005778; Score: 0.56
DE  Interaction: P30282; IntAct: EBI-1005844; Score: 0.53
DE  Interaction: P06400; IntAct: EBI-1182824; Score: 0.62
DE  Interaction: P63087; IntAct: EBI-1202851; Score: 0.00
DE  Interaction: Q01105; IntAct: EBI-1371868; Score: 0.35
DE  Interaction: Q8CIG8; IntAct: EBI-2941146; Score: 0.50
DE  Interaction: Q99J09; IntAct: EBI-3401852; Score: 0.35
DE  Interaction: O15211; IntAct: EBI-3956301; Score: 0.40
DE  Interaction: P46527; IntAct: EBI-12737659; Score: 0.35
DE  Interaction: P51480; IntAct: EBI-15653801; Score: 0.35
DE  Interaction: Q60772; IntAct: EBI-15653801; Score: 0.35
DE  Interaction: P55271; IntAct: EBI-15653855; Score: 0.35
DE  Interaction: P09936; IntAct: EBI-27097896; Score: 0.40
DE  Interaction: Q9R0P9; IntAct: EBI-27121708; Score: 0.35
GO  GO:0005923;
GO  GO:0000785;
GO  GO:0097128;
GO  GO:0097129;
GO  GO:0097130;
GO  GO:0000307;
GO  GO:0005737;
GO  GO:0005829;
GO  GO:0016592;
GO  GO:0031965;
GO  GO:0005730;
GO  GO:0005654;
GO  GO:0005634;
GO  GO:0048471;
GO  GO:0032991;
GO  GO:0005667;
GO  GO:0005524;
GO  GO:0030332;
GO  GO:0004693;
GO  GO:0016301;
GO  GO:0004672;
GO  GO:0106310;
GO  GO:0004674;
GO  GO:0044877;
GO  GO:0008353;
GO  GO:0060612;
GO  GO:0051301;
GO  GO:0032869;
GO  GO:0071353;
GO  GO:1904637;
GO  GO:0071222;
GO  GO:1904628;
GO  GO:0000082;
GO  GO:0043065;
GO  GO:0008284;
GO  GO:0045793;
GO  GO:0050679;
GO  GO:0048146;
GO  GO:0010971;
GO  GO:0045727;
GO  GO:0006468;
GO  GO:0051726;
GO  GO:0010468;
GO  GO:0046626;
GO  GO:0046890;
GO  GO:0050994;
GO  GO:0040014;
GO  GO:0061469;
GO  GO:0010288;
GO  GO:0010033;
GO  GO:0033574;
GO  GO:0009410;
GO  GO:0007165;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPNVVRLMDVCAT
SQ  SRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFG
SQ  LARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
SQ  EVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEESDAE
//