ID P35354; PN Prostaglandin G/H synthase 2; GN PTGS2; OS 9606; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0179; SL Nucleus Position: SL-0182; SL Nucleus Position: SL-0183; SL Comments: Microsome membrane {ECO:0000269|PubMed:9545330}; Peripheral membrane protein. Endoplasmic reticulum membrane {ECO:0000269|PubMed:9545330}; Peripheral membrane protein. Nucleus inner membrane {ECO:0000269|PubMed:9545330}; Peripheral membrane protein. Nucleus outer membrane {ECO:0000269|PubMed:9545330}; Peripheral membrane protein. Note=Detected on the lumenal side of the endoplasmic reticulum and nuclear envelope. {ECO:0000269|PubMed:9545330}. DR UNIPROT: P35354; DR UNIPROT: A8K802; DR UNIPROT: Q16876; DR PDB: 5F19; DR PDB: 5F1A; DR PDB: 5IKQ; DR PDB: 5IKR; DR PDB: 5IKT; DR PDB: 5IKV; DR PDB: 5KIR; DR Pfam: PF03098; DR Pfam: PF00008; DR PROSITE: PS50026; DR PROSITE: PS50292; DR OMIM: 600262; DR DisGeNET: 5743; DE Function: Dual cyclooxygenase and peroxidase in the biosynthesis pathway of prostanoids, a class of C20 oxylipins mainly derived from arachidonate, with a particular role in the inflammatory response (PubMed:7947975, PubMed:7592599, PubMed:9261177, PubMed:16373578, PubMed:22942274, PubMed:26859324, PubMed:27226593, PubMed:11939906, PubMed:19540099). The cyclooxygenase activity oxygenates arachidonate (AA, C20:4(n-6)) to the hydroperoxy endoperoxide prostaglandin G2 (PGG2), and the peroxidase activity reduces PGG2 to the hydroxy endoperoxide PGH2, the precursor of all 2-series prostaglandins and thromboxanes (PubMed:7947975, PubMed:7592599, PubMed:9261177, PubMed:16373578, PubMed:22942274, PubMed:26859324, PubMed:27226593). This complex transformation is initiated by abstraction of hydrogen at carbon 13 (with S-stereochemistry), followed by insertion of molecular O2 to form the endoperoxide bridge between carbon 9 and 11 that defines prostaglandins. The insertion of a second molecule of O2 (bis-oxygenase activity) yields a hydroperoxy group in PGG2 that is then reduced to PGH2 by two electrons (PubMed:7947975, PubMed:7592599, PubMed:9261177, PubMed:16373578, PubMed:22942274, PubMed:26859324, PubMed:27226593). Similarly catalyzes successive cyclooxygenation and peroxidation of dihomo-gamma-linoleate (DGLA, C20:3(n-6)) and eicosapentaenoate (EPA, C20:5(n-3)) to corresponding PGH1 and PGH3, the precursors of 1- and 3- series prostaglandins (PubMed:11939906, PubMed:19540099). In an alternative pathway of prostanoid biosynthesis, converts 2-arachidonoyl lysophopholipids to prostanoid lysophopholipids, which are then hydrolyzed by intracellular phospholipases to release free prostanoids (PubMed:27642067). Metabolizes 2-arachidonoyl glycerol yielding the glyceryl ester of PGH2, a process that can contribute to pain response (PubMed:22942274). Generates lipid mediators from n-3 and n-6 polyunsaturated fatty acids (PUFAs) via a lipoxygenase-type mechanism. Oxygenates PUFAs to hydroperoxy compounds and then reduces them to corresponding alcohols (PubMed:11034610, PubMed:11192938, PubMed:9048568, PubMed:9261177). Plays a role in the generation of resolution phase interaction products (resolvins) during both sterile and infectious inflammation (PubMed:12391014). Metabolizes docosahexaenoate (DHA, C22:6(n-3)) to 17R-HDHA, a precursor of the D- series resolvins (RvDs) (PubMed:12391014). As a component of the biosynthetic pathway of E-series resolvins (RvEs), converts eicosapentaenoate (EPA, C20:5(n-3)) primarily to 18S-HEPE that is further metabolized by ALOX5 and LTA4H to generate 18S-RvE1 and 18S- RvE2 (PubMed:21206090). In vascular endothelial cells, converts docosapentaenoate (DPA, C22:5(n-3)) to 13R-HDPA, a precursor for 13- series resolvins (RvTs) shown to activate macrophage phagocytosis during bacterial infection (PubMed:26236990). In activated leukocytes, contributes to oxygenation of hydroxyeicosatetraenoates (HETE) to diHETES (5,15-diHETE and 5,11-diHETE) (PubMed:22068350, PubMed:26282205). During neuroinflammation, plays a role in neuronal secretion of specialized preresolving mediators (SPMs) 15R-lipoxin A4 that regulates phagocytic microglia (By similarity). {ECO:0000250|UniProtKB:Q05769, ECO:0000269|PubMed:11034610, ECO:0000269|PubMed:11192938, ECO:0000269|PubMed:11939906, ECO:0000269|PubMed:12391014, ECO:0000269|PubMed:16373578, ECO:0000269|PubMed:21206090, ECO:0000269|PubMed:22068350, ECO:0000269|PubMed:22942274, ECO:0000269|PubMed:26236990, ECO:0000269|PubMed:26282205, ECO:0000269|PubMed:26859324, ECO:0000269|PubMed:27226593, ECO:0000269|PubMed:27642067, ECO:0000269|PubMed:7592599, ECO:0000269|PubMed:7947975, ECO:0000269|PubMed:9048568, ECO:0000269|PubMed:9261177, ECO:0000303|PubMed:19540099}. DE Reference Proteome: Yes; DE Interaction: Q9WMX2; IntAct: EBI-9083640; Score: 0.37 DE Interaction: Q5S007; IntAct: EBI-9515510; Score: 0.35 DE Interaction: O14936; IntAct: EBI-21252062; Score: 0.37 DE Interaction: Q9H0V9; IntAct: EBI-21845712; Score: 0.35 DE Interaction: P35354; IntAct: EBI-15578876; Score: 0.40 DE Interaction: P04439; IntAct: EBI-20910216; Score: 0.40 DE Interaction: Q86V38; IntAct: EBI-25846357; Score: 0.56 GO GO:0005901; GO GO:0005737; GO GO:0005783; GO GO:0005788; GO GO:0005789; GO GO:0043231; GO GO:0043005; GO GO:0005637; GO GO:0005640; GO GO:0032991; GO GO:0019899; GO GO:0020037; GO GO:0046872; GO GO:0016702; GO GO:0004601; GO GO:0004666; GO GO:0042803; GO GO:0007568; GO GO:0001525; GO GO:0030282; GO GO:0050873; GO GO:0071318; GO GO:0071498; GO GO:0034605; GO GO:0071456; GO GO:0071284; GO GO:0071260; GO GO:0071471; GO GO:0034644; GO GO:0019371; GO GO:0046697; GO GO:0007566; GO GO:0042633; GO GO:0006954; GO GO:0007612; GO GO:0035633; GO GO:0007613; GO GO:0051926; GO GO:0045786; GO GO:0008285; GO GO:0043154; GO GO:1902219; GO GO:0045986; GO GO:0032227; GO GO:0030728; GO GO:0043065; GO GO:0090336; GO GO:0090050; GO GO:0031622; GO GO:0090271; GO GO:0045429; GO GO:0033138; GO GO:0090362; GO GO:0031394; GO GO:0042307; GO GO:0048661; GO GO:0045987; GO GO:0031915; GO GO:0051968; GO GO:0071636; GO GO:0010575; GO GO:0045907; GO GO:0001516; GO GO:0032310; GO GO:0008217; GO GO:0050727; GO GO:0150077; GO GO:1990776; GO GO:0032355; GO GO:0070542; GO GO:0009750; GO GO:0051384; GO GO:0032496; GO GO:0010226; GO GO:0010042; GO GO:0009624; GO GO:0006979; GO GO:0034612; GO GO:0033280; GO GO:0009410; GO GO:0019233; TP Membrane Topology: Peripheral; Source: UniProt - Sequence Analysis; SQ MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTH SQ FKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDS SQ NEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY SQ QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRL SQ ILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSIL SQ LEHGITQFVESFTRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL SQ YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKG SQ CPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL //