ID P38937; PN Tethering factor for nuclear proteasome cut8; GN cut8; OS 284812; SL Nucleus Position: SL-0178; SL Comments: Nucleus envelope {ECO:0000269|PubMed:11084332, ECO:0000269|PubMed:28974540}. DR UNIPROT: P38937; DR PDB: 3Q5W; DR PDB: 3Q5X; DR Pfam: PF08559; DE Function: Together with nucleoporin alm1, tethers the proteasome to the nuclear envelope (PubMed:28974540, PubMed:11084332, PubMed:16096059). Involved in ubiquitin-mediated protein degradation and facilitates the degradation of nuclear proteins like mitotic cyclin and cut2 (PubMed:11084332, PubMed:16096059). Required for normal progression of anaphase (PubMed:8065367, PubMed:11084332). {ECO:0000269|PubMed:11084332, ECO:0000269|PubMed:16096059, ECO:0000269|PubMed:28974540, ECO:0000269|PubMed:8065367}. DE Reference Proteome: Yes; DE Interaction: P50524; IntAct: EBI-1152618; Score: 0.52 DE Interaction: P41878; IntAct: EBI-1152637; Score: 0.40 DE Interaction: P87048; IntAct: EBI-1152745; Score: 0.54 DE Interaction: P40303; IntAct: EBI-1152891; Score: 0.40 DE Interaction: P23566; IntAct: EBI-1153015; Score: 0.43 DE Interaction: P38937; IntAct: EBI-15946480; Score: 0.62 GO GO:0000785; GO GO:0005635; GO GO:0034399; GO GO:0005634; GO GO:0042802; GO GO:0032934; GO GO:0034080; GO GO:0071630; GO GO:0031144; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ METLSYSQIKKRKADFDEDISKRARQLPVGEQLPLSRLLQYSDKQQLFTILLQCVEKHPDLARDIRGILPAPSMDTCVET SQ LRKLLINLNDSFPYGGDKRGDYAFNRIREKYMAVLHALNDMVPCYLPPYSTCFEKNITFLDAATNVVHELPEFHNPNHNV SQ YKSQAYYELTGAWLVVLRQLEDRPVVPLLPLEELEEHNKTSQNRMEEALNYLKQLQKNEPLVHERSHTFQQTNPQNNFHR SQ HTNSMNIGNDNGMGWHSMHQYI //