ID P41917; PN GTP-binding nuclear protein Ran-2; GN RAN2; OS 3702; SL Nucleus Position: SL-0178; SL Comments: Nucleus {ECO:0000269|PubMed:17530257}. Nucleus envelope {ECO:0000269|PubMed:17530257}. Note=Localized in the perinuclear region with the highest concentration at the nuclear envelope at the interphase. DR UNIPROT: P41917; DR UNIPROT: Q0WVD9; DR UNIPROT: Q94K33; DR Pfam: PF00071; DR PROSITE: PS51418; DE Function: GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; DE Interaction: Q8RWG8; IntAct: EBI-2325944; Score: 0.37 DE Interaction: Q9LMK7; IntAct: EBI-2325973; Score: 0.37 DE Interaction: Q9SHQ6; IntAct: EBI-12596165; Score: 0.40 DE Interaction: F4K567; IntAct: EBI-12596177; Score: 0.40 GO GO:0005737; GO GO:0005794; GO GO:0005635; GO GO:0005730; GO GO:0005634; GO GO:0009536; GO GO:0005525; GO GO:0003924; GO GO:0003729; GO GO:0006606; GO GO:0000054; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRD SQ GYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNF SQ EKPFLYLARKLAGDQNLHFVESPALAPPEVHLDIAAQQQNEADLAAAAAQPLPDDDDDAFE //