ID P49791; PN Nuclear pore complex protein Nup153; GN Nup153; OS 10116; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Nucleus Position: SL-0185; SL Comments: Nucleus. Nucleus membrane. Nucleus, nuclear pore complex. Note=Dissociates from the NPC structure early during prophase of mitosis. Integrated in the newly assembled nuclear envelope of postmitotic cells early in G1 (By similarity). Localized to the nucleoplasmic side of the nuclear pore complex (NPC) core structure, forming a fibrous structure called the nuclear basket. Tightly associated with the nuclear membrane and lamina. Colocalized with NUP98 and TPR to the nuclear basket at the nucleoplasmic side of the NPC. Detected in diffuse and discrete intranuclear foci. {ECO:0000250}. DR UNIPROT: P49791; DR PDB: 2K0C; DR PDB: 3CH5; DR PDB: 3GJ3; DR PDB: 3GJ4; DR PDB: 3GJ5; DR PDB: 3GJ6; DR PDB: 3GJ7; DR PDB: 3GJ8; DR Pfam: PF08604; DR Pfam: PF10599; DR Pfam: PF00641; DR PROSITE: PS01358; DR PROSITE: PS50199; DE Function: Component of the nuclear pore complex (NPC), a complex required for the trafficking across the nuclear envelope. Functions as a scaffolding element in the nuclear phase of the NPC essential for normal nucleocytoplasmic transport of proteins and mRNAs. Involved in the quality control and retention of unspliced mRNAs in the nucleus; in association with TPR, regulates the nuclear export of unspliced mRNA species bearing constitutive transport element (CTE) in a NXF1- and KHDRBS1-independent manner. Mediates TPR anchoring to the nuclear membrane at NPC (By similarity). The repeat-containing domain may be involved in anchoring other components of the NPC to the pore membrane. Possible DNA-binding subunit of the nuclear pore complex (NPC) (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; DE Interaction: Q53FT3; IntAct: EBI-6140559; Score: 0.44 DE Interaction: P62826; IntAct: EBI-15714795; Score: 0.67 DE Interaction: P08922; IntAct: EBI-22248889; Score: 0.35 DE Interaction: P35968; IntAct: EBI-22252650; Score: 0.35 GO GO:0005642; GO GO:0016020; GO GO:0005635; GO GO:0042405; GO GO:0031965; GO GO:0034399; GO GO:0005643; GO GO:0044615; GO GO:1990875; GO GO:0032991; GO GO:0003682; GO GO:0003690; GO GO:0042802; GO GO:0008139; GO GO:0043495; GO GO:0031267; GO GO:0017056; GO GO:0008270; GO GO:0000278; GO GO:0051028; GO GO:0046832; GO GO:0051292; GO GO:0006606; GO GO:0006405; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MASGAGGIGGGGGGGKIRTRRCHQGPVKPYQQGRPQHQGILSRVTESVKNIVPGWLQRYFNKSENACSCSVNADEVPRWP SQ ENREDEREIYVDENTNTDDGRTTPEPTGSNTEEPSTTSTASNYPDVLTRPSLHRSHLNFSVLESPALHCQPSTSSAFPIG SQ SSGFSLVKEIKDSTSQHDDDNISTTSGFSSRASEKDIAVSKNTSLPPLWSPEAERSHSLSQHTAISSKKPAFNLSAFGTL SQ STSLGNSSILKTSQLGDSPFYPGKTTYGGAAAAVRQNKVRSTPYQAPVRRQMKAKQLNAQSYGVTSSTARRILQSLEKMS SQ SPLADAKRIPSAVSSPLNSPLDRSGIDSTVFQAKKEKVDSQYPPVQRLMTPKPVSIATNRTVYFKPSLTPSGDLRKTNQR SQ IDKKNSTVDEKNISRQNREQESGFSYPNFSIPAANGLSSGVGGGGGKMRRERTTHFVASKPSEEEEVEVPLLPQISLPIS SQ SSSLPTFNFSSPAISAASSSSVSPSQPLSNKVQMTSLGSTGNPVFTFSSPIVKSTQADVLPPASIGFTFSVPLAKTELSG SQ PNSSSETVLSSSVTAQDNTVVNSSSSKKRSAPCEDPFTPAKILREGSVLDILKTPGFMSPKVDSPALQPTTTSSIVYTRP SQ AISTFSSSGVEFGESLKAGSSWQCDTCLLQNKVTDNKCIACQAAKLPLKETAKQTGIGTPSKSDKPASTSGTGFGDKFKP SQ AIGTWDCDTCLVQNKPEAVKCVACETPKPGTGVKRALPLTVASESPVTASSSTTVTTGTLGFGDKFKRPVGSWECPVCCV SQ SNKAEDSRCVSCTSEKPGLVSASSSNSVPVSLPSGGCLGLDKFKKPEGSWDCEVCLVQNKADSTKCIACESAKPGTKSEF SQ KGFGTSSSLNPAPSAFKFGIPSSSSGLSQTFTSTGNFKFGDQGGFKLGTSSDSGSTNTMNTNFKFPKPTGDFKFGVLPDS SQ KPEEIKNDSKNDNFQFGPSSGLSNPASSAPFQFGVSTLGQQEKKEELPQSSSAGFSFGAGVANPSSAAIDTTVTSENKSG SQ FNFGTIDTKSVSVTPFTYKTTEAKKEDASATKGGFTFGKVDSAALSSPSMFVLGRTEEKQQEPVTSTSLVFGKKADNEEP SQ KCQPVFSFGNSEQTKDESSSKPTFSFSVAKPSVKESDQLAKATFAFGNQTNTTTDQGAAKPAFSFLNSSSSSSSTPATSS SQ SASIFGSSTSSSSPPVAAFVFGQASNPVSSSAFGNSAESSTSQPLLFPQDGKPATTSSTASAAPPFVFGTGASSNSTVSS SQ GFTFGATTTSSSSGSFFVFGTGHSAPSASPAFGANQTPTFGQSQGASQPNPPSFGSISSSTALFSAGSQPVPPPTFGTVS SQ SSSQPPVFGQQPSQSAFGSGTANASSVFQFGSSTTNFNFTNNNPSGVFTFGASPSTPAAAAQPSGSGGFSFSQSPASFTV SQ GSNGKNMFSSSGTSVSGRKIKTAVRRKK //