ID  P50995;
PN  Annexin A11;
GN  ANXA11;
OS  9606;
SL  Nucleus Position: SL-0178;
SL  Comments: Cytoplasm {ECO:0000269|PubMed:28469040}. Melanosome. Nucleus envelope. Nucleus, nucleoplasm {ECO:0000269|PubMed:28469040}. Cytoplasm, cytoskeleton, spindle. Note=Found throughout the nucleoplasm at interphase and during mitosis concentrates around the mitotic apparatus (By similarity). Elevation of intracellular calcium causes relocalization from the nucleoplasm to the nuclear envelope, with little effect on the cytoplasmic pool. Localization to the nuclear envelope is cell-cycle dependent. {ECO:0000250}.
DR  UNIPROT: P50995;
DR  UNIPROT: B4DVE7;
DR  Pfam: PF00191;
DR  PROSITE: PS00223;
DR  PROSITE: PS51897;
DR  OMIM: 602572;
DR  OMIM: 617839;
DR  DisGeNET: 311;
DE  Function: Binds specifically to calcyclin in a calcium-dependent manner (By similarity). Required for midbody formation and completion of the terminal phase of cytokinesis. {ECO:0000250, ECO:0000269|PubMed:15197175}.
DE  Disease: Amyotrophic lateral sclerosis 23 (ALS23) [MIM:617839]: A form of amyotrophic lateral sclerosis, a neurodegenerative disorder affecting upper motor neurons in the brain and lower motor neurons in the brain stem and spinal cord, resulting in fatal paralysis. Sensory abnormalities are absent. The pathologic hallmarks of the disease include pallor of the corticospinal tract due to loss of motor neurons, presence of ubiquitin-positive inclusions within surviving motor neurons, and deposition of pathologic aggregates. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5- 10% of the cases. ALS23 is an autosomal dominant form with incomplete penetrance. {ECO:0000269|PubMed:28469040}. Note=The disease is caused by variants affecting the gene represented in this entry.
DE  Reference Proteome: Yes;
DE  Interaction: O15162; IntAct: EBI-752707; Score: 0.55
DE  Interaction: P00533; IntAct: EBI-34582286; Score: 0.35
DE  Interaction: P09104; IntAct: EBI-731812; Score: 0.00
DE  Interaction: P31942; IntAct: EBI-734775; Score: 0.00
DE  Interaction: O75340; IntAct: EBI-2338752; Score: 0.75
DE  Interaction: Q5NHS4; IntAct: EBI-2808973; Score: 0.00
DE  Interaction: A0A6L8PQC3; IntAct: EBI-2838236; Score: 0.00
DE  Interaction: A0A380PL96; IntAct: EBI-2843651; Score: 0.00
DE  Interaction: Q99459; IntAct: EBI-7954144; Score: 0.35
DE  Interaction: Q93034; IntAct: EBI-21331078; Score: 0.35
DE  Interaction: Q8IUH5; IntAct: EBI-9090498; Score: 0.37
DE  Interaction: P05412; IntAct: EBI-11324725; Score: 0.35
DE  Interaction: P08563; IntAct: EBI-11477906; Score: 0.40
DE  Interaction: Q9WVM1; IntAct: EBI-11008211; Score: 0.35
DE  Interaction: Q80UG5; IntAct: EBI-11121465; Score: 0.35
DE  Interaction: Q91ZJ0; IntAct: EBI-11131714; Score: 0.35
DE  Interaction: Q8NI38; IntAct: EBI-24751877; Score: 0.56
DE  Interaction: Q96AE4; IntAct: EBI-24374647; Score: 0.56
DE  Interaction: Q53EZ4; IntAct: EBI-24386584; Score: 0.78
DE  Interaction: Q3LI66; IntAct: EBI-24537226; Score: 0.56
DE  Interaction: Q9NZC7; IntAct: EBI-24573309; Score: 0.56
DE  Interaction: Q52LG2; IntAct: EBI-24587720; Score: 0.56
DE  Interaction: P15289; IntAct: EBI-24600393; Score: 0.56
DE  Interaction: Q92734; IntAct: EBI-12700650; Score: 0.67
DE  Interaction: P36810; IntAct: EBI-26503730; Score: 0.49
DE  Interaction: P60033; IntAct: EBI-20568535; Score: 0.35
DE  Interaction: Q15828; IntAct: EBI-21887792; Score: 0.40
DE  Interaction: Q12888; IntAct: EBI-20207896; Score: 0.27
DE  Interaction: O60260; IntAct: EBI-21135687; Score: 0.35
DE  Interaction: P83105; IntAct: EBI-25745135; Score: 0.35
DE  Interaction: Q9C0B5; IntAct: EBI-25636144; Score: 0.35
GO  GO:0042582;
GO  GO:0062023;
GO  GO:0005737;
GO  GO:0005829;
GO  GO:0070062;
GO  GO:0042470;
GO  GO:0016020;
GO  GO:0030496;
GO  GO:0005635;
GO  GO:0005654;
GO  GO:0045335;
GO  GO:0042581;
GO  GO:0005819;
GO  GO:0005509;
GO  GO:0005544;
GO  GO:0048306;
GO  GO:0023026;
GO  GO:0008429;
GO  GO:0003723;
GO  GO:0044548;
GO  GO:0032506;
GO  GO:0006909;
GO  GO:0051592;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGA
SQ  GYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPL
SQ  PGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILL
SQ  SFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKK
SQ  TLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQR
SQ  MTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKS
SQ  LYHDISGDTSGDYRKILLKICGGND
//