ID P51491; PN Short-wave-sensitive opsin 1; GN Opn1sw; OS 10090; SL Nucleus Position: SL-0198; SL Comments: Cell membrane {ECO:0000250|UniProtKB:P03999}; Multi-pass membrane protein {ECO:0000255}. Photoreceptor inner segment {ECO:0000269|PubMed:21219924}. Cell projection, cilium, photoreceptor outer segment {ECO:0000269|PubMed:21219924}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:P03999}. DR UNIPROT: P51491; DR UNIPROT: Q548Z8; DR Pfam: PF00001; DR PROSITE: PS00237; DR PROSITE: PS50262; DR PROSITE: PS00238; DE Function: Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal (By similarity). Required for the maintenance of cone outer segment organization in the ventral retina, but not essential for the maintenance of functioning cone photoreceptors (PubMed:21219924, PubMed:25416279). Involved in ensuring correct abundance and localization of retinal membrane proteins (PubMed:25416279). May increase spectral sensitivity in dim light (PubMed:11055434). {ECO:0000250|UniProtKB:P03999, ECO:0000269|PubMed:11055434, ECO:0000269|PubMed:21219924, ECO:0000269|PubMed:25416279}. DE Reference Proteome: Yes; GO GO:0044297; GO GO:0120199; GO GO:0005887; GO GO:0048471; GO GO:0001917; GO GO:0001750; GO GO:0005886; GO GO:0043195; GO GO:0008020; GO GO:0071482; GO GO:0071492; GO GO:0007186; GO GO:0007602; GO GO:0007601; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MSGEDDFYLFQNISSVGPWDGPQYHLAPVWAFRLQAAFMGFVFFVGTPLNAIVLVATLHYKKLRQPLNYILVNVSLGGFL SQ FCIFSVFTVFIASCHGYFLFGRHVCALEAFLGSVAGLVTGWSLAFLAFERYVVICKPFGSIRFNSKHALMVVLATWIIGI SQ GVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSEYYTWFLFIFCFIIPLSLICFSYSQLLRTLRAVAAQQQESATTQK SQ AEREVSHMVVVMVGSFCLCYVPYAALAMYMVNNRNHGLDLRLVTIPAFFSKSSCVYNPIIYCFMNKQFRACILEMVCRKP SQ MADESDVSGSQKTEVSTVSSSKVGPH //