ID  P53011;
PN  Nucleoporin SEH1;
GN  SEH1;
OS  559292;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0182;
SL  Nucleus Position: SL-0185;
SL  Comments: Nucleus, nuclear pore complex {ECO:0000269|PubMed:10684247}. Nucleus membrane {ECO:0000269|PubMed:10684247}; Peripheral membrane protein {ECO:0000269|PubMed:10684247}; Cytoplasmic side {ECO:0000269|PubMed:10684247}. Vacuole membrane {ECO:0000269|PubMed:21454883}; Peripheral membrane protein {ECO:0000269|PubMed:21454883}. Nucleus membrane {ECO:0000269|PubMed:10684247}; Peripheral membrane protein {ECO:0000269|PubMed:10684247}; Nucleoplasmic side {ECO:0000269|PubMed:10684247}. Note=Symmetric distribution. {ECO:0000269|PubMed:10684247}.
DR  UNIPROT: P53011;
DR  UNIPROT: D6VU45;
DR  PDB: 3EWE;
DR  PDB: 3F3F;
DR  PDB: 3F3G;
DR  PDB: 3F3P;
DR  PDB: 4XMM;
DR  PDB: 6X08;
DR  PDB: 7N84;
DR  PDB: 7N9F;
DR  Pfam: PF00400;
DR  PROSITE: PS50082;
DR  PROSITE: PS50294;
DE  Function: Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Involved in nuclear poly(A)+ RNA export and NPC biogenesis. It is also required for normal nuclear morphology. Component of the SEA complex which coats the vacuolar membrane and is involved in intracellular trafficking, autophagy, response to nitrogen starvation, and amino acid biogenesis. {ECO:0000269|PubMed:10684247, ECO:0000269|PubMed:11823431, ECO:0000269|PubMed:12206772, ECO:0000269|PubMed:21454883, ECO:0000269|PubMed:8565072}.
DE  Reference Proteome: Yes;
DE  Interaction: P35729; IntAct: EBI-800487; Score: 0.91
DE  Interaction: P46673; IntAct: EBI-1580856; Score: 0.92
DE  Interaction: P49687; IntAct: EBI-797641; Score: 0.81
DE  Interaction: P52891; IntAct: EBI-800196; Score: 0.64
DE  Interaction: P38305; IntAct: EBI-761900; Score: 0.40
DE  Interaction: Q12315; IntAct: EBI-849734; Score: 0.32
DE  Interaction: P40018; IntAct: EBI-784510; Score: 0.35
DE  Interaction: P09440; IntAct: EBI-785631; Score: 0.35
DE  Interaction: P41543; IntAct: EBI-785977; Score: 0.35
DE  Interaction: P41811; IntAct: EBI-786711; Score: 0.35
DE  Interaction: P18888; IntAct: EBI-793082; Score: 0.35
DE  Interaction: P32639; IntAct: EBI-798593; Score: 0.35
DE  Interaction: Q04491; IntAct: EBI-812133; Score: 0.53
DE  Interaction: P32357; IntAct: EBI-814258; Score: 0.27
DE  Interaction: P32582; IntAct: EBI-815440; Score: 0.27
DE  Interaction: P53919; IntAct: EBI-858574; Score: 0.00
DE  Interaction: Q99257; IntAct: EBI-8220602; Score: 0.47
DE  Interaction: Q02630; IntAct: EBI-1269890; Score: 0.00
DE  Interaction: P34232; IntAct: EBI-7700687; Score: 0.35
DE  Interaction: P13186; IntAct: EBI-2612251; Score: 0.35
DE  Interaction: P21965; IntAct: EBI-2612461; Score: 0.35
DE  Interaction: P32472; IntAct: EBI-2883301; Score: 0.00
DE  Interaction: Q06677; IntAct: EBI-3758933; Score: 0.35
DE  Interaction: P38788; IntAct: EBI-3791596; Score: 0.35
DE  Interaction: P39078; IntAct: EBI-3822714; Score: 0.35
DE  Interaction: P31539; IntAct: EBI-3827816; Score: 0.35
DE  Interaction: Q03330; IntAct: EBI-4385804; Score: 0.35
DE  Interaction: P47170; IntAct: EBI-9821605; Score: 0.58
DE  Interaction: P39923; IntAct: EBI-9819823; Score: 0.35
DE  Interaction: P38742; IntAct: EBI-9819915; Score: 0.35
DE  Interaction: Q08281; IntAct: EBI-9819987; Score: 0.35
DE  Interaction: Q03897; IntAct: EBI-9820072; Score: 0.53
DE  Interaction: P38164; IntAct: EBI-9820321; Score: 0.50
DE  Interaction: Q8WUM0; IntAct: EBI-11890201; Score: 0.40
DE  Interaction: Q08496; IntAct: EBI-16268078; Score: 0.35
DE  Interaction: P09734; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P37291; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P39954; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P41277; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P05694; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P00817; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P07342; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P04806; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P15108; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P38720; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P07262; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P04397; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P00924; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P29311; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P53090; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P37302; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: Q05911; IntAct: EBI-16281928; Score: 0.35
DE  Interaction: P19414; IntAct: EBI-16281928; Score: 0.35
GO  GO:0097042;
GO  GO:0005635;
GO  GO:0031965;
GO  GO:0005643;
GO  GO:0031080;
GO  GO:0035859;
GO  GO:0005774;
GO  GO:0017056;
GO  GO:0034198;
GO  GO:0051028;
GO  GO:0006913;
GO  GO:1904263;
GO  GO:0015031;
GO  GO:1903432;
TP  Membrane Topology: Peripheral; Source: UniProt - Experimental Evidence {ECO:0000269|PubMed:10684247};
SQ  MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKT
SQ  VKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIP
SQ  PANHLQSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRI
SQ  RIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILS
SQ  SAGDDGKVRLWKATYSNEFKCMSVITAQQ
//