ID P53062; PN Nucleus export protein BRR6; GN BRR6; OS 559292; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Nucleus membrane {ECO:0000269|PubMed:11483521, ECO:0000269|PubMed:14562095}; Multi-pass membrane protein {ECO:0000269|PubMed:11483521, ECO:0000269|PubMed:14562095}. DR UNIPROT: P53062; DR UNIPROT: D6VV88; DR Pfam: PF10104; DE Function: Required for mRNA nuclear export. Involved in the nuclear pore complex (NPC) distribution and nuclear envelope morphology. {ECO:0000269|PubMed:11483521, ECO:0000269|PubMed:15882446}. DE Reference Proteome: Yes; DE Interaction: P25611; IntAct: EBI-2347149; Score: 0.37 DE Interaction: P11484; IntAct: EBI-3778254; Score: 0.35 GO GO:0071944; GO GO:0005783; GO GO:0016021; GO GO:0005635; GO GO:0031965; GO GO:0055088; GO GO:0051028; GO GO:0006998; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MELRSFSRQPDGILANPRLGREEVLEGEHPQDARLARQSIWLSPSLIAEYIQLFFNFIIGTIGLSLAIKFILMIRNDVNL SQ KLEHNVREELDKIATCKSRYFENQCEPHMRVPALEVRCNEWSKCMNKEIVSGSDYQWAKAWARTLAEVINAFFEAFSIRS SQ FLFILISIIGIIFVTNTSFGSYRVYLNNKDTKSVRHA //