ID  P60192;
PN  SNARE-associated protein Snapin;
GN  Snapin;
OS  10116;
SL  Nucleus Position: SL-0198;
SL  Comments: Membrane {ECO:0000250|UniProtKB:Q9Z266}; Peripheral membrane protein {ECO:0000250|UniProtKB:Q9Z266}; Cytoplasmic side {ECO:0000250|UniProtKB:Q9Z266}. Cytoplasm, cytosol {ECO:0000250|UniProtKB:Q9Z266}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q9Z266}. Golgi apparatus membrane {ECO:0000250|UniProtKB:Q9Z266}. Lysosome membrane {ECO:0000250|UniProtKB:O95295}. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane {ECO:0000269|PubMed:18167355}. Note=Colocalizes with NANOS1 and PUM2 in the perinuclear region of germ cells. {ECO:0000250|UniProtKB:O95295}.
DR  UNIPROT: P60192;
DR  Pfam: PF14712;
DE  Function: Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Plays a role in intracellular vesicle trafficking and synaptic vesicle recycling. May modulate a step between vesicle priming, fusion and calcium-dependent neurotransmitter release through its ability to potentiate the interaction of synaptotagmin with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. May also have a role in the mechanisms of SNARE- mediated membrane fusion in non-neuronal cells (PubMed:10195194, PubMed:11283605). As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor (By similarity). {ECO:0000250|UniProtKB:O95295, ECO:0000269|PubMed:10195194, ECO:0000269|PubMed:11283605}.
DE  Reference Proteome: Yes;
DE  Interaction: P19357; IntAct: EBI-921030; Score: 0.35
DE  Interaction: P21139; IntAct: EBI-7089219; Score: 0.27
DE  Interaction: Q06486; IntAct: EBI-7089182; Score: 0.27
DE  Interaction: Q68FS2; IntAct: EBI-8514670; Score: 0.35
DE  Interaction: D3ZCV0; IntAct: EBI-5351457; Score: 0.40
DE  Interaction: O35433; IntAct: EBI-26900768; Score: 0.40
DE  Interaction: Q9WUD2; IntAct: EBI-26900776; Score: 0.40
GO  GO:0001669;
GO  GO:0070161;
GO  GO:1904115;
GO  GO:0031083;
GO  GO:0099078;
GO  GO:0031410;
GO  GO:0005829;
GO  GO:0000139;
GO  GO:0005765;
GO  GO:0002177;
GO  GO:0048471;
GO  GO:0030141;
GO  GO:0045202;
GO  GO:0008021;
GO  GO:0030672;
GO  GO:0000149;
GO  GO:0008089;
GO  GO:0048490;
GO  GO:0097352;
GO  GO:0007268;
GO  GO:0008333;
GO  GO:0051650;
GO  GO:0006886;
GO  GO:1902774;
GO  GO:0007042;
GO  GO:0032418;
GO  GO:0007040;
GO  GO:0010977;
GO  GO:0070050;
GO  GO:0031175;
GO  GO:0051604;
GO  GO:0031503;
GO  GO:0043393;
GO  GO:2000300;
GO  GO:0008090;
GO  GO:0016079;
GO  GO:0031629;
GO  GO:0016188;
GO  GO:0048489;
GO  GO:0072553;
TP  Membrane Topology: Peripheral; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:Q9Z266};
SQ  MAAAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDP
SQ  YVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGVYPPGSPSK
//