ID P61512; PN Protein V2; GN V2; OS 37139; SL Nucleus Position: SL-0382; SL Comments: Host cytoplasm, host perinuclear region {ECO:0000250}. Note=Accumulates in inclusion bodies in the cell periphery. May interact with the ER network from the perinuclear region out to the cell periphery (By similarity). {ECO:0000250}. DR UNIPROT: P61512; DR UNIPROT: P27270; DR Pfam: PF01524; DR Pfam: PF03716; DE Function: Through its interaction with host SGS3, acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. {ECO:0000250}. DE Reference Proteome: No; GO GO:0044220; GO GO:0019048; GO GO:0060967; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MWDPLLNEFPDSVHGLRCMLAIKYLQLVEETYEPNTLGHDLIRDLISVIRARDYAEANRRYTNFNARLEGSSKTELRQPV SQ YQPCCCPHCPRHQASIMDLQAHVSKAADVQNVQKP //