ID  P62834;
PN  Ras-related protein Rap-1A;
GN  RAP1A;
OS  9606;
SL  Nucleus Position: SL-0198;
SL  Comments: Cell membrane {ECO:0000269|PubMed:11359771}; Lipid-anchor {ECO:0000269|PubMed:11359771}. Cytoplasm {ECO:0000269|PubMed:11359771}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:11359771}. Cell junction {ECO:0000250}. Early endosome {ECO:0000250}. Note=Recruited from early endosome to late endosome compartment after nerve growth factor (NGF) stimulation. Localized with RAPGEF2 at cell-cell junctions (By similarity). Colocalized with RAPGEF2 in the perinuclear region. {ECO:0000250}.
DR  UNIPROT: P62834;
DR  UNIPROT: P10113;
DR  PDB: 1C1Y;
DR  PDB: 1GUA;
DR  PDB: 3KUC;
DR  PDB: 4KVG;
DR  Pfam: PF00071;
DR  PROSITE: PS51421;
DR  OMIM: 179520;
DR  DisGeNET: 5906;
DE  Function: Induces morphological reversion of a cell line transformed by a Ras oncogene. Counteracts the mitogenic function of Ras, at least partly because it can interact with Ras GAPs and RAF in a competitive manner. Together with ITGB1BP1, regulates KRIT1 localization to microtubules and membranes. Plays a role in nerve growth factor (NGF)- induced neurite outgrowth. Plays a role in the regulation of embryonic blood vessel formation. Involved in the establishment of basal endothelial barrier function. May be involved in the regulation of the vascular endothelial growth factor receptor KDR expression at endothelial cell-cell junctions. {ECO:0000269|PubMed:17916086, ECO:0000269|PubMed:21840392}.
DE  Reference Proteome: Yes;
DE  Interaction: P03246; IntAct: EBI-11722343; Score: 0.35
DE  Interaction: Q9Z0S9; IntAct: EBI-491425; Score: 0.40
DE  Interaction: Q8WWW0; IntAct: EBI-960490; Score: 0.65
DE  Interaction: Q5EBH1; IntAct: EBI-961174; Score: 0.61
DE  Interaction: P04049; IntAct: EBI-1026035; Score: 0.62
DE  Interaction: Q9UET6; IntAct: EBI-1063157; Score: 0.00
DE  Interaction: P40337; IntAct: EBI-1074441; Score: 0.00
DE  Interaction: Q9Y4K3; IntAct: EBI-1083743; Score: 0.00
DE  Interaction: P48039; IntAct: EBI-1188258; Score: 0.53
DE  Interaction: P30153; IntAct: EBI-1266406; Score: 0.35
DE  Interaction: Q14697; IntAct: EBI-3917532; Score: 0.37
DE  Interaction: P25445; IntAct: EBI-6590523; Score: 0.27
DE  Interaction: Q8TDF6; IntAct: EBI-6590814; Score: 0.27
DE  Interaction: P63104; IntAct: EBI-8758913; Score: 0.44
DE  Interaction: Q9Y4G8; IntAct: EBI-8766309; Score: 0.44
DE  Interaction: P03182; IntAct: EBI-11721938; Score: 0.35
DE  Interaction: P06460; IntAct: EBI-11723082; Score: 0.35
DE  Interaction: P06461; IntAct: EBI-11723785; Score: 0.35
DE  Interaction: P06792; IntAct: EBI-11724527; Score: 0.35
DE  Interaction: P0C739; IntAct: EBI-11725101; Score: 0.35
DE  Interaction: Q80X90; IntAct: EBI-11053320; Score: 0.35
DE  Interaction: Q9UHB6; IntAct: EBI-11058729; Score: 0.35
DE  Interaction: Q9WUM4; IntAct: EBI-11065690; Score: 0.35
DE  Interaction: P46940; IntAct: EBI-11132927; Score: 0.35
DE  Interaction: Q99IB8; IntAct: EBI-11599534; Score: 0.35
DE  Interaction: Q12967; IntAct: EBI-11682848; Score: 0.37
DE  Interaction: Q9NRW4; IntAct: EBI-21542541; Score: 0.35
DE  Interaction: Q9BQ48; IntAct: EBI-21664135; Score: 0.35
DE  Interaction: Q8TAG9; IntAct: EBI-21673041; Score: 0.35
DE  Interaction: O14880; IntAct: EBI-21690017; Score: 0.35
DE  Interaction: Q92845; IntAct: EBI-21702814; Score: 0.35
DE  Interaction: Q6PUV4; IntAct: EBI-21722654; Score: 0.35
DE  Interaction: P52306; IntAct: EBI-21808615; Score: 0.35
DE  Interaction: Q969Z0; IntAct: EBI-21877137; Score: 0.35
DE  Interaction: Q13905; IntAct: EBI-15953082; Score: 0.44
DE  Interaction: P36957; IntAct: EBI-20305285; Score: 0.35
DE  Interaction: P00441; IntAct: EBI-20307497; Score: 0.35
DE  Interaction: O14979; IntAct: EBI-20923226; Score: 0.40
DE  Interaction: Q14103; IntAct: EBI-20923218; Score: 0.40
DE  Interaction: O43924; IntAct: EBI-21019227; Score: 0.35
DE  Interaction: P03372; IntAct: EBI-21301141; Score: 0.35
DE  Interaction: Q8N6Q3; IntAct: EBI-21402192; Score: 0.35
DE  Interaction: P51636; IntAct: EBI-25383812; Score: 0.35
DE  Interaction: Q96T52; IntAct: EBI-27049069; Score: 0.27
DE  Interaction: Q9H300; IntAct: EBI-27049982; Score: 0.27
DE  Interaction: Q8N488; IntAct: EBI-27110926; Score: 0.35
DE  Interaction: P15056; IntAct: EBI-27094546; Score: 0.40
GO  GO:0070161;
GO  GO:0030054;
GO  GO:0005737;
GO  GO:0005829;
GO  GO:0005769;
GO  GO:0010008;
GO  GO:0070062;
GO  GO:0098978;
GO  GO:0032045;
GO  GO:0005770;
GO  GO:0043005;
GO  GO:0048471;
GO  GO:0005886;
GO  GO:0098793;
GO  GO:0035579;
GO  GO:0097225;
GO  GO:0003925;
GO  GO:0019003;
GO  GO:0005525;
GO  GO:0003924;
GO  GO:0005085;
GO  GO:0044877;
GO  GO:0031267;
GO  GO:0071320;
GO  GO:1990090;
GO  GO:0061028;
GO  GO:2000301;
GO  GO:0038180;
GO  GO:0007399;
GO  GO:0070374;
GO  GO:0043547;
GO  GO:0010976;
GO  GO:0045860;
GO  GO:2001214;
GO  GO:0072659;
GO  GO:0032486;
GO  GO:1901888;
GO  GO:0098696;
GO  GO:0016079;
TP  Membrane Topology: Lipid-Anchored; Source: UniProt - Experimental Evidence {ECO:0000269|PubMed:1899909};
SQ  MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFAL
SQ  VYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQWCNCAFLESSAKSKINVNEIFYD
SQ  LVRQINRKTPVEKKKPKKKSCLLL
//