ID  P63004;
PN  Platelet-activating factor acetylhydrolase IB subunit alpha;
GN  Pafah1b1;
OS  10116;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0182;
SL  Comments: Cytoplasm, cytoskeleton {ECO:0000255|HAMAP- Rule:MF_03141}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000255|HAMAP-Rule:MF_03141}. Cytoplasm, cytoskeleton, spindle {ECO:0000255|HAMAP-Rule:MF_03141}. Nucleus membrane {ECO:0000255|HAMAP-Rule:MF_03141}. Note=Localizes to the plus end of microtubules and to the centrosome. May localize to the nuclear membrane. Also localizes to the microtubules of the manchette in elongating spermatids and to the meiotic spindle in spermatocytes (By similarity). Redistributes to axons during neuronal development. {ECO:0000255|HAMAP-Rule:MF_03141, ECO:0000269|PubMed:11001923, ECO:0000269|PubMed:11056530, ECO:0000269|PubMed:16481446}.
DR  UNIPROT: P63004;
DR  UNIPROT: O35592;
DR  UNIPROT: P43035;
DR  UNIPROT: P81692;
DR  UNIPROT: Q9R2A6;
DR  Pfam: PF08513;
DR  Pfam: PF00400;
DR  PROSITE: PS50896;
DR  PROSITE: PS00678;
DR  PROSITE: PS50082;
DR  PROSITE: PS50294;
DE  Function: Regulatory subunit (beta subunit) of the cytosolic type I platelet-activating factor (PAF) acetylhydrolase (PAF-AH (I)), an enzyme that catalyzes the hydrolyze of the acetyl group at the sn-2 position of PAF and its analogs and participates in PAF inactivation. Regulates the PAF-AH (I) activity in a catalytic dimer composition- dependent manner (By similarity). Required for proper activation of Rho GTPases and actin polymerization at the leading edge of locomoting cerebellar neurons and postmigratory hippocampal neurons in response to calcium influx triggered via NMDA receptors. Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for several dynein- and microtubule- dependent processes such as the maintenance of Golgi integrity, the peripheral transport of microtubule fragments and the coupling of the nucleus and centrosome. Required during brain development for the proliferation of neuronal precursors and the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Neuronal migration involves a process called nucleokinesis, whereby migrating cells extend an anterior process into which the nucleus subsequently translocates. During nucleokinesis dynein at the nuclear surface may translocate the nucleus towards the centrosome by exerting force on centrosomal microtubules. May also play a role in other forms of cell locomotion including the migration of fibroblasts during wound healing. Required for dynein recruitment to microtubule plus ends and BICD2-bound cargos (By similarity). May modulate the Reelin pathway through interaction of the PAF-AH (I) catalytic dimer with VLDLR (By similarity). {ECO:0000250|UniProtKB:P43033, ECO:0000250|UniProtKB:P43034, ECO:0000250|UniProtKB:P63005, ECO:0000269|PubMed:11056532, ECO:0000269|PubMed:16144905}.
DE  Reference Proteome: Yes;
DE  Interaction: P19357; IntAct: EBI-921030; Score: 0.35
DE  Interaction: Q78PB6; IntAct: EBI-27039409; Score: 0.40
GO  GO:0008247;
GO  GO:0000235;
GO  GO:0030424;
GO  GO:1904115;
GO  GO:0005938;
GO  GO:0031252;
GO  GO:0090724;
GO  GO:0005813;
GO  GO:0005737;
GO  GO:0005881;
GO  GO:0005829;
GO  GO:0030426;
GO  GO:0005871;
GO  GO:0000776;
GO  GO:0005875;
GO  GO:0015630;
GO  GO:0031514;
GO  GO:0043005;
GO  GO:0043025;
GO  GO:0005635;
GO  GO:0031965;
GO  GO:0048471;
GO  GO:0032420;
GO  GO:0045202;
GO  GO:0031982;
GO  GO:0070840;
GO  GO:0045505;
GO  GO:0042802;
GO  GO:0008017;
GO  GO:0051010;
GO  GO:0051219;
GO  GO:0047179;
GO  GO:0046982;
GO  GO:0044877;
GO  GO:0001675;
GO  GO:0030036;
GO  GO:0008344;
GO  GO:0001667;
GO  GO:0060117;
GO  GO:0007420;
GO  GO:0048854;
GO  GO:0016477;
GO  GO:0021987;
GO  GO:0021895;
GO  GO:0007268;
GO  GO:0090102;
GO  GO:0021540;
GO  GO:0043622;
GO  GO:0051660;
GO  GO:0051649;
GO  GO:0000132;
GO  GO:0042249;
GO  GO:0007281;
GO  GO:0021766;
GO  GO:1904936;
GO  GO:0007254;
GO  GO:0021819;
GO  GO:0007611;
GO  GO:0016042;
GO  GO:0051661;
GO  GO:0000226;
GO  GO:0090176;
GO  GO:0031023;
GO  GO:0051012;
GO  GO:0007017;
GO  GO:0097529;
GO  GO:0046329;
GO  GO:0010977;
GO  GO:0007405;
GO  GO:0050885;
GO  GO:0001764;
GO  GO:0051081;
GO  GO:0007097;
GO  GO:0036035;
GO  GO:0045773;
GO  GO:0051130;
GO  GO:0001961;
GO  GO:0061003;
GO  GO:0040019;
GO  GO:0045931;
GO  GO:0009306;
GO  GO:0140650;
GO  GO:0038026;
GO  GO:0043087;
GO  GO:0070507;
GO  GO:0008090;
GO  GO:0017145;
GO  GO:0019226;
GO  GO:0047496;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDMNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFT
SQ  SGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDH
SQ  SGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMV
SQ  RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTI
SQ  KMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSV
SQ  DQTVKVWECR
//