ID P82471; PN Guanine nucleotide-binding protein G(q) subunit alpha; GN Gnaq; OS 10116; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Cell membrane {ECO:0000250|UniProtKB:P50148}; Lipid-anchor {ECO:0000250|UniProtKB:P50148}. Golgi apparatus {ECO:0000250|UniProtKB:P50148}. Nucleus {ECO:0000250|UniProtKB:P21279}. Nucleus membrane {ECO:0000250|UniProtKB:P21279}. Note=Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes. {ECO:0000250|UniProtKB:P21279}. DR UNIPROT: P82471; DR Pfam: PF00503; DR PROSITE: PS51882; DE Function: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Required for platelet activation. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells (in vitro) (By similarity). Transduces FFAR4 signaling in response to long- chain fatty acids (LCFAs) (By similarity). Together with GNA11, required for heart development (By similarity). {ECO:0000250|UniProtKB:P21279, ECO:0000250|UniProtKB:P50148}. DE Reference Proteome: Yes; DE Interaction: Q5XIE8; IntAct: EBI-26438079; Score: 0.35 GO GO:0005901; GO GO:0044297; GO GO:0005829; GO GO:0030425; GO GO:0005794; GO GO:0005834; GO GO:0016020; GO GO:0031965; GO GO:0005886; GO GO:0045202; GO GO:0047391; GO GO:0001664; GO GO:0031683; GO GO:0005525; GO GO:0005096; GO GO:0003924; GO GO:0046872; GO GO:0044877; GO GO:0001508; GO GO:0007202; GO GO:0007189; GO GO:0007188; GO GO:1904888; GO GO:0048066; GO GO:0042733; GO GO:0086100; GO GO:0021884; GO GO:0007186; GO GO:0007215; GO GO:0007507; GO GO:0042711; GO GO:0010259; GO GO:0043066; GO GO:0043267; GO GO:0006469; GO GO:0016322; GO GO:0060158; GO GO:0007200; GO GO:0048661; GO GO:0009791; GO GO:0050821; GO GO:0008217; GO GO:0060828; GO GO:0045634; GO GO:0010543; GO GO:0001501; TP Membrane Topology: Lipid-Anchored; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:P21279}; SQ MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVY SQ QNIFTAMQAMVRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYY SQ LNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV SQ ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDS SQ DKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV //